(data stored in ACNUC30630 zone)

EMBL: CP002010.PE178

CP002010.PE178       Location/Qualifiers
FT   CDS_pept        complement(243675..245129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0187"
FT                   /product="FRG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99677"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN1"
FT                   /protein_id="ADG99677.1"
FT                   /translation="MLKDEEHHEHVSALPSIAKITQATPNLMAISPNMTHQLLDTIQKT
FT                   PEISNNLRLISTPLKTSTSAIQTFLEQQEKALKTISNLSSSTILSSIKPIQDSLRDALA
FT                   KFDFAHYDEKYLNVYSGISQVLKQYEETQSNLQKYYRSITPSYFHSSNESPHYYSPEMT
FT                   SPSDFFDSKSGRIESIEDLNNAILLLQKHVSNIPLYWRGQNNASWGLHSKLFRLLMTQN
FT                   GVVSPQQKPKTKQPYPTEDQMIQAEKQILNLARQDWRYGNMSALEIFARIQHFGGPTRL
FT                   LDASCNPYIAAWFAVYDPTHEHEDHDARLFALAGYASGNNEQPDYSEELLSRDPFWFNL
FT                   HDYEQRAAANWGTGSRRIVWRPPEYESRIAAQNAVFILDGIPITNSRILQYFRKPTGKE
FT                   YWKRPDILAASSIYAKPFSPNHNARPNQRNLAPTYSFVIAKKAKKEIRSYLEGAFGYRE
FT                   SFIYPDFAGLASKTNNIQFPNLGDLQ"
     atgcttaagg atgaagaaca ccatgaacat gtaagcgcgt tgccgtctat agcgaaaata        60
     acgcaagcaa cgccgaatct aatggcaata agccccaaca tgacgcatca gctgctagat       120
     accattcaaa aaaccccaga aatcagcaac aacctgcgac ttatatccac tcccctcaaa       180
     acaagcactt cagcaattca aactttccta gagcagcaag agaaagccct caaaacaatc       240
     tctaacttat cttcaagcac aatcctgtct tccataaaac ctattcagga cagccttcgt       300
     gacgcactag caaaatttga ttttgctcat tacgacgaaa aatatctgaa cgtatattcc       360
     gggatttcgc aagtattaaa acaatatgaa gagacacaat caaacctgca aaaatattat       420
     cgatccataa cccctagtta tttccatagc tctaacgagt cacctcatta ctactctcct       480
     gagatgacca gtccttcaga tttttttgac tccaaaagtg gacgcatcga gagtatagaa       540
     gatttaaata atgcaatcct tctactgcaa aagcatgtat caaatatacc gttatactgg       600
     cgaggacaaa ataatgcctc ttggggacta catagcaaat tatttcgcct actgatgacg       660
     caaaatggag ttgtttcccc tcaacagaag cccaaaacca aacagcccta tccgaccgaa       720
     gaccagatga ttcaagctga gaagcagatt cttaatcttg ctcgtcaaga ctggcgatat       780
     ggaaacatgt ctgctttaga gatattcgca cgcattcagc actttggcgg ccccacacgc       840
     ctactcgacg catcctgcaa cccatatata gctgcttggt tcgccgtcta tgacccaacg       900
     cacgagcacg aagatcatga cgcgcgccta ttcgctttag ctggatacgc atcaggcaat       960
     aatgagcaac cagactactc cgaagaactg ctaagtcgcg accctttctg gttcaacctg      1020
     cacgattacg agcaacgcgc agcagccaac tggggaaccg gatcacgccg tatcgtatgg      1080
     cgtccaccag aatacgaatc acgtatcgct gctcaaaatg cagtatttat cctcgatgga      1140
     attccaatta caaatagtcg aatccttcaa tattttcgca agcctacggg caaagaatat      1200
     tggaagaggc cagatatact cgcagcttcc tcaatttatg caaagccctt ctcgccaaat      1260
     cacaacgcac gtccgaatca acgcaatcta gcaccaacgt attcattcgt cattgccaag      1320
     aaagctaaga aagagatacg aagttaccta gaaggcgcgt ttggataccg cgagtccttc      1380
     atctaccccg atttcgcagg cctagcaagt aaaacaaaca atatccagtt cccaaatcta      1440
     ggtgatcttc aatag                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page