(data stored in ACNUC30630 zone)

EMBL: CP002010.PE180

CP002010.PE180       Location/Qualifiers
FT   CDS_pept        complement(246353..248053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99679"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN3"
FT                   /protein_id="ADG99679.1"
FT                   /translation="METSYEQVLEAVRRYPRDLKLQELPRDTSGRQHAQCSCPAHDGDG
FT                   GTSLHITYDQSDGKTMLHCFGAEHCDAAAIADAPGLKIIDLFDQQSGPQGHAGYSSYNS
FT                   YSCDSRLTAADLASIRHANAPLLNRNETTTITPTHTENSAEIRQQYAMPKPYLEPLVLG
FT                   QSPMFAAICAAIAVQPNIGLLHGTCPNCGTADSLTVLYSPLESATLLRCSTCQADDVLN
FT                   ALNAPATLARSNGYEAMIYDSERGTAYEYADGLIVRRSPAKRISQSGNTADKHPLWMAA
FT                   DAKRAVALGKPVYLTEGEKDAGTLRALGYAAVTAAGGGGNFATKLDLDSARSALSGADV
FT                   VAIVDKDDTGARWKEQVAQTLTPFVRSLTFIQAAGEAHDASDAAMSGVEFEILPRESIQ
FT                   HESELEPELMSRAYSLTRLADVEPERPLWLWPGHIPKGKIVLIDGDPATGKSTLALDIA
FT                   AHVTTGAAWPDGSAGCEPANVLLLTAEDGLADTVSPRIRAAQGDASKMFALSEVFKDGK
FT                   EVAITLTDALPQIAQAAREQHIGLIVVDVLISFLGSDTNSYKDQIFAHR"
     atggagacct catatgagca agtgctcgaa gcagtgagac gctatccgcg agatctcaag        60
     cttcaagagc ttccgcgcga cacctccgga agacaacatg cacagtgcag ctgcccagcc       120
     catgacggag acggcggcac ttcgctgcac atcacctacg accagtccga cggcaaaacc       180
     atgctgcact gcttcggagc ggaacactgc gatgccgctg ccattgccga tgcaccggga       240
     ttgaaaatca tcgacctgtt cgaccaacaa agcggacctc aaggccatgc cggttacagc       300
     agctacaaca gttacagctg cgatagccgg ctcactgccg ccgatttggc gtccatacgg       360
     catgcgaatg ctccacttct caacagaaat gagacaacga cgattacacc tacgcacacg       420
     gaaaactctg cggaaatcag acaacagtac gcgatgccca aaccgtactt ggaaccattg       480
     gtcttaggcc aatcccctat gttcgccgcc atctgcgcag ctattgcagt tcagccaaat       540
     atcggcctgt tgcacggcac ttgcccaaac tgcggcacag ccgactcgct cactgtgctg       600
     tattccccgc tggaaagcgc cacattgctc cggtgcagca cttgccaagc cgacgatgta       660
     ctcaacgcac tgaacgctcc cgctacgctg gctcgttcca atggctatga agcaatgatc       720
     tacgacagcg agcgcggcac agcatacgaa tatgcggacg gtctgattgt ccgccgctca       780
     ccggccaagc gaatctcaca aagcggcaac accgccgaca agcacccatt gtggatggcc       840
     gccgacgcga aacgtgccgt ggcattgggc aagccagtgt atctgacgga gggagaaaaa       900
     gatgccggca cattgcgagc gctcggctat gccgctgtaa ccgcagcggg aggtggcggc       960
     aacttcgcca cgaaactgga tctcgattcg gctcgctcag cccttagtgg ggctgatgtg      1020
     gttgccattg tggataagga cgacactggc gctcgctgga aggagcaagt ggcgcagacg      1080
     ctgacgccgt tcgtgcgatc actgactttt atccaagcag ctggcgaggc tcacgatgct      1140
     tccgacgctg cgatgagcgg cgtggaattc gagattctgc caagagaaag tatccagcat      1200
     gagtctgagc tcgagcctga gctgatgtcc cgcgcctatt cgctgacccg tttggctgat      1260
     gtggaaccgg agcgaccgtt gtggttgtgg ccgggccaca ttcccaaggg gaagatcgta      1320
     ctgattgacg gcgatccggc gactggcaaa agcactttgg ccttggatat tgcagctcac      1380
     gtcaccacgg gagcagcatg gccggatggg tccgctggat gcgagcctgc gaacgtgctg      1440
     ctgttgactg cggaagacgg actggcggac accgtgagcc cacgcattcg cgccgcacaa      1500
     ggcgacgcat ccaagatgtt cgccctatcg gaggtcttca aggatggcaa ggaggtagcg      1560
     attacgctca ccgacgcact gccacagata gcacaggctg cgcgtgagca gcatatcggc      1620
     ctgattgtcg tggatgtgct gatatcgttt ttgggcagcg acaccaacag ctacaaggat      1680
     cagatattcg cgcacaggtg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page