(data stored in ACNUC30630 zone)

EMBL: CP002010.PE181

CP002010.PE181       Location/Qualifiers
FT   CDS_pept        complement(248056..248250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0190"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99680"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN4"
FT                   /protein_id="ADG99680.1"
FT                   /translation="MAAIPTKNDYPRLTAKPAQVTEMLGYKDVKSVYGLIRTGKIRARK
FT                   VGNTFLVNLTSVREFAGEE"
     atggctgcaa ttccaacgaa gaacgactat ccgcgtctca ccgccaagcc agcgcaagtg        60
     acagagatgc tgggatacaa ggacgtgaaa agtgtctacg ggttaatcag aaccggaaag       120
     attcgcgccc gcaaggtagg taacacgttt ctggtgaatc tcaccagcgt gcgcgaattc       180
     gcaggtgagg agtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page