(data stored in ACNUC30630 zone)

EMBL: CP002010.PE183

CP002010.PE183       Location/Qualifiers
FT   CDS_pept        250857..252224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0192"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99682"
FT                   /db_xref="GOA:D6ZXN6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN6"
FT                   /protein_id="ADG99682.1"
FT                   /translation="MNGASGSRRSWGKIRVKKVHGGTSYYAEYPDPRPDRKGDDGRRER
FT                   IRSPFVFSSRQAAEGWLAQQRNRIDGGIWVDPRDEYEDSASARKAEERRSESFRDYAER
FT                   WFGGKIARGEIRPSTVRTYRQRLDGVLYPAFGDKAMRDITVEDVERWYEEMGRPRKVDG
FT                   RPSTKERPRLSTRGNAYGLLRQIMQSACTAPNAILDFNPCQIKGGSAHKGKERAVIGPE
FT                   KVREIADNMPGKYRLVVLLGFWLSLRMGEILALRRRDIDLDGKVVRITHAVTYSKEYGF
FT                   VDGDPKTEAGVRSIPIPDGLVAEIRKHIDEYADPGDDGKLFHTATGNYVHHSEVEKAFI
FT                   KARRKAGCEDVVLHGLRHSGNTYFAQNTNATIADLQARGGWSTSSMAAHYMHSSQDRLR
FT                   QLTKEMSAANTVHETGSDNSAGAASELESLRSQLEEANKKNNELMQLVTERYGTKK"
     atgaacggag cgagtggatc gcgcaggagc tggggcaaga tcagggtgaa gaaggtgcat        60
     ggcggcactt cctattacgc ggaatacccc gatcccagac ccgacaggaa gggcgatgac       120
     gggaggcgtg agcgcatccg ttcgcctttc gtgttcagca gcaggcaggc cgccgagggg       180
     tggctcgccc agcagaggaa ccgcatcgac ggcggcatct gggtcgaccc ccgcgatgag       240
     tatgaggatt cggcttccgc gaggaaggcc gaggagcggc gttcggagtc cttccgtgat       300
     tatgccgaac gctggttcgg tggcaagatc gcccgtggtg agatccgtcc ctccacggtg       360
     cgcacgtatc ggcagcggtt ggacggtgtg ctgtatcccg cgttcgggga caaggccatg       420
     cgtgacatca ccgtggagga cgtcgagcgt tggtatgagg agatgggcag gccgcgcaag       480
     gtggacggca ggccgtcgac caaggagagg ccgcgtttga gcacccgtgg caacgcctac       540
     ggtctgctca ggcagatcat gcagtcggcc tgcaccgcgc ccaacgcgat actggacttc       600
     aatccctgcc agatcaaggg cggctccgcc cacaagggca aggagcgcgc ggtcataggg       660
     ccggagaagg tgcgggagat cgccgacaac atgccgggca aataccggct ggtggtgctt       720
     ctgggattct ggctgtcgct gcgtatgggc gagatcctcg ccctgcggcg cagggacata       780
     gaccttgacg gcaaggtggt ccgcatcacg cacgccgtga cctattccaa ggaatacggt       840
     ttcgtcgacg gcgatcccaa gaccgaggcc ggcgtacgct cgatacccat tccggacggt       900
     ctcgtggccg agatcaggaa acacatcgac gaatacgccg accccggcga tgacggcaag       960
     ctgttccaca ccgccaccgg caactacgtc catcattcgg aggtcgagaa ggcgttcatc      1020
     aaggcgcgca ggaaagccgg ctgcgaggac gtggtgctgc atggcctgag gcacagcggc      1080
     aacacctact tcgcacagaa caccaatgcc accatcgccg acctgcaagc gcgcggcggc      1140
     tggtccacct cctcgatggc cgcccactac atgcacagct cccaagaccg gttgaggcag      1200
     ctgaccaagg aaatgagcgc tgcgaatact gtccatgaga ccggaagcga caacagcgcc      1260
     ggagccgcaa gcgagcttga atcactgcgc agccaacttg aggaagccaa taagaaaaac      1320
     aacgagctga tgcagctcgt tacggaaagg tacggaacca aaaaatag                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page