(data stored in ACNUC30630 zone)

EMBL: CP002010.PE186

CP002010.PE186       Location/Qualifiers
FT   CDS_pept        255704..256723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0195"
FT                   /product="membrane protein involved in colicin uptake"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99685"
FT                   /db_xref="GOA:D6ZXN9"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN9"
FT                   /protein_id="ADG99685.1"
FT                   /translation="MTKPSEEVETMDDATPEESKPKGIRPANLTAVIVAAVVVALAGIG
FT                   GGYAYWTHHEGNAYHEAVAQAENADKALMKAVDEATATTYKADQLKEPKLLDKLNEQVK
FT                   KAESLKGIPDDNPSEWLAWRLASAKKANATDADEANAQAKALNAALKAVKDSRLAKELD
FT                   TAKDQLKQGIDGAGQTLKDTDGKVADNATRDSLAKAIDEANNALSKKGVTDPKTYTDAK
FT                   AKLDEAVRQVTDSKAAKEQADAEAAAQAQAQAQAAAQAQAAAQAAAQPQRSYSQSYNRY
FT                   GGSGSGYSSNRGYSAPQQSYTPSSNGGGSSYSGPTITGGGISNNDNGNGQPIGSEGLL"
     atgacgaagc catcagagga agtggaaacc atggatgacg ccaccccaga ggagagcaag        60
     cccaagggta tcaggcccgc caacctcacc gccgtcatcg tcgcggcggt ggtcgtggcg       120
     ctggcgggca tcggcggcgg ctacgcctac tggacgcacc acgagggcaa cgcctatcat       180
     gaggcggtag cccaagccga gaacgccgac aaggcgctca tgaaggccgt ggacgaggcc       240
     acagccacca catacaaggc ggatcagctc aaggagccga agctgctgga caagctcaac       300
     gagcaggtaa agaaggcgga atccctcaag ggtattcccg acgataaccc cagcgaatgg       360
     ttggcgtggc ggctcgcttc cgcgaagaag gccaatgcca cggacgcgga cgaggccaac       420
     gcccaagcga aggcgctcaa cgccgcgctc aaggccgtca aggacagcag gctggcgaag       480
     gagctggaca ccgcgaagga ccagctcaag cagggtatcg acggcgcggg ccagaccctc       540
     aaggacacgg acgggaaggt ggcggacaac gccacccgcg acagcctcgc gaaggccatc       600
     gacgaggcga acaacgccct ttccaagaag ggcgtcaccg acccgaagac gtacaccgac       660
     gccaaggcga agctggacga ggccgtcagg caggtgaccg attcgaaggc cgcgaaggag       720
     caggccgacg ccgaggccgc cgcccaagcc caagcccaag cgcaggccgc cgcccaagcg       780
     caggcagccg cgcaagccgc cgcgcagccg caacgctcct actcccagtc ctacaaccgt       840
     tacggcggct ccggcagcgg gtattcctcc aaccgtgggt attccgcccc gcagcagtcc       900
     tacaccccat ccagcaacgg cggcggctcc tcctatagcg gccccaccat taccggcggt       960
     ggaatctcca acaatgacaa tggaaatggt cagcccattg gcagcgaagg cctgctctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page