(data stored in ACNUC30630 zone)

EMBL: CP002010.PE193

CP002010.PE193       Location/Qualifiers
FT   CDS_pept        266909..268132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0203"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99692"
FT                   /db_xref="GOA:D6ZXP6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP6"
FT                   /protein_id="ADG99692.1"
FT                   /translation="MTNTGMFFRMLFSAVFRRRSRAVMAVVASLVGAATLFCLAMICLA
FT                   VPQQMNEEMRAYGANLIVTPTESTNADGKAGIDKAMVQHTTEMVKAKGSAKYATYRYEN
FT                   VRVNASPYVMAGVNAAQVKNLNHHWVVDGSWPTDGKVLVGRDIADAIGLRIGSAITIGY
FT                   RASDNASTNGTSSNSSIDQQTKDGRVSSDIMDTSGTEFRVAGIVDTGGSEDSIIYATNA
FT                   DVNKLTGITRGVDVIEYSAGASDLAGLVSSINDMTSMHVKAQQVTKITASDTRIITMLQ
FT                   TLFWIVSLVVLVLTLVGVGTTISSIVSQRRNEIGLRKALGASSRAIGTEFYIESSLYGL
FT                   IGGLIGTAIGYGLASWLCVAVFERSIGFNWWLALISVLFSALVAIVASIPPVHRATRID
FT                   PAVVLREE"
     atgaccaaca ccggtatgtt cttcagaatg ctgttcagcg ccgtgttccg ccggcgttcg        60
     cgcgcggtga tggccgtggt ggcgtcgctg gtcggcgcgg ccacactgtt ctgcctggcg       120
     atgatctgcc tcgccgtgcc gcagcagatg aacgaggaga tgcgtgcgta cggcgcgaac       180
     ctgattgtca cacccaccga atcgaccaat gccgacggca aggccggcat cgacaaggcg       240
     atggtgcagc acaccactga aatggtcaag gccaagggtt ccgcgaaata cgccacttac       300
     cgctacgaga acgtgcgcgt caacgcctcg ccgtacgtga tggccggcgt gaacgcggcg       360
     caggtcaaga acctcaacca tcactgggtg gtcgacggct cgtggccgac cgacggcaag       420
     gtgctggtcg gacgtgacat cgccgacgcc atcggtctga gaatcggctc cgccatcacc       480
     atcggctacc gtgcatccga taacgccagc accaacggca cttcgtcgaa ctcctcgatc       540
     gaccagcaaa ccaaagacgg ccgcgtttcc agcgacatca tggacacctc cggcaccgaa       600
     ttccgcgtgg ccggcatcgt ggacaccggc ggcagtgagg actcgatcat ctacgccacc       660
     aacgccgacg tcaacaagct caccggcatc acgcgcggcg tggacgtcat cgagtattcg       720
     gccggcgcca gcgatctcgc gggcctggtg tccagcatca acgacatgac ctccatgcac       780
     gtcaaggcgc agcaggtcac caagatcacc gcctccgaca cccgcatcat caccatgctg       840
     cagacgctgt tctggatcgt ctcgctggtg gtgctggtgc tgacgctcgt cggcgtcggc       900
     accacaatca gctcgatcgt ctcgcagcga cgcaacgaga tcggcctgcg caaggccctc       960
     ggtgccagct cgcgtgccat cggcaccgag ttctacatcg aatcatcgct ctacggcctg      1020
     attggcggcc tcatcggcac cgcaatcggc tacggactcg ccagttggct gtgcgtggcg      1080
     gtgttcgaac gctccatcgg attcaactgg tggctggcgc tgatctccgt gctgttcagc      1140
     gcgctggtcg ccatcgtcgc ctccatcccg cccgtccacc gcgccacccg catcgacccc      1200
     gctgtcgtgc ttcgcgaaga ataa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page