(data stored in ACNUC30630 zone)

EMBL: CP002010.PE2

CP002010.PE2         Location/Qualifiers
FT   CDS_pept        2448..3572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99501"
FT                   /db_xref="GOA:D6ZX55"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX55"
FT                   /protein_id="ADG99501.1"
FT                   /translation="MKVEIDTAALADAVAWTSRVIDARPSNPILAGVKLEAIDGTLQFS
FT                   AFNYEISARHHIEAGVDEAGSVLVQGKLLADITKSLRSEKTYLVTDGSTLTITSGKSKF
FT                   TLQLMPDTEYPDLPVVPAMLGQVDAPTFVQAVNQACVAVSREENRPVLTGVRMQFQGDK
FT                   VVMTSTDRFRLARATFTWTPQNPDVDTTTLVRGSLLKDVARALDEHQNIRLDFDADSPT
FT                   LLGFENAGRVSTSQLIDGEFPAVDRLFADEYPIQAVVNKQDLLDAISRVALVAERNAPI
FT                   RMTFTGQEVALSAGSVDEAQANETLDIDMDGDDITVAFNPSYLKEGLSAVTEPFVRIKM
FT                   TTPVKPVEFNGQQEADSDESMDYRYLLVPMRFNN"
     atgaaagtcg aaatcgatac tgcagccctg gccgacgccg tagcctggac ctcccgagtc        60
     atcgacgcac gtccctccaa cccgattctc gctggtgtca agctggaagc cattgacgga       120
     acgctgcaat tctccgcctt caactacgag atttccgctc gccaccacat cgaagccggc       180
     gttgacgaag ccggttccgt actggttcag ggcaagctgc tggccgatat caccaaatcg       240
     ctgcgttcgg agaaaacgta cctggtcacc gacggctcca cgctgaccat cacgtccggc       300
     aagtcgaagt tcaccttgca gctcatgccc gacaccgagt acccggatct gcctgtggta       360
     ccggccatgc tcggccaagt cgatgccccg actttcgttc aggcagtgaa ccaggcatgc       420
     gttgccgtct cccgcgaaga aaaccgcccg gtactgaccg gcgttcgcat gcaattccaa       480
     ggcgacaagg tcgtcatgac ctccaccgat cgcttccgtt tggcccgcgc caccttcact       540
     tggactccgc agaacccgga cgtcgacacc accacgctgg ttcgcggctc cctgctcaag       600
     gatgtggccc gtgctcttga cgagcaccag aacatccgcc ttgatttcga tgccgatagc       660
     ccgacgctgc tcggcttcga aaacgccggc cgcgtctcca cctcccagct catcgacggt       720
     gaattcccgg cggtcgaccg cctgttcgcc gacgaatacc cgattcaggc cgtagtcaac       780
     aagcaggatc tgctcgacgc catcagccgt gtggctttgg tcgccgaacg caatgctccg       840
     attcgcatga ccttcaccgg tcaggaagtg gcgctgtccg ccggatcggt cgacgaggcc       900
     caggccaacg aaacactgga catcgacatg gatggcgacg acatcaccgt ggcattcaac       960
     ccgtcctacc tgaaggaggg tctgtccgcc gtgaccgaac cattcgtgcg catcaagatg      1020
     acgaccccgg tcaagccggt cgagttcaac ggccagcagg aagctgattc cgacgagtcc      1080
     atggactacc gatacctgct cgtgccgatg cgcttcaaca actga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page