(data stored in ACNUC30630 zone)

EMBL: CP002010.PE202

CP002010.PE202       Location/Qualifiers
FT   CDS_pept        complement(280132..281157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99701"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ5"
FT                   /protein_id="ADG99701.1"
FT                   /translation="MIIDMPNTRTREIAHKIEQLHEERGESATGRVLTLLIATEDADLE
FT                   HALEIANSASREHPCRVIAVVPDTNPADQSGEGEPNETEVAAGVSANRDNPAVDLTDGP
FT                   NDPNDSNLNAQVRFGADAGAGEIIILRPRGGLINHPDTLVIPLLVPDAPVVAWWPTTPP
FT                   SNPAKDLMGAMARSRITDALHSNNPEATIERLRRNWTPEDIDLSWTRLTVWRAMLASML
FT                   DQPPHLPITAVKVTGKADFLPLEMLCAWLRLKLGVPVETEFVPDAQAVTGVYLTREDGV
FT                   ISLERPYEDQALISLPGQTPQEVSVPMRTIEDCLTEELRRIDPDEIYAEVINEGWDLIR
FT                   H"
     atgatcatcg atatgccgaa cacccgcacc cgcgagattg cgcacaaaat cgaacagctg        60
     cacgaggagc gcggcgaatc ggcgaccggc cgcgtgctga cgctactcat cgccaccgag       120
     gacgcggacc tagagcatgc gctggaaatc gcgaactcgg ccagccgtga gcacccgtgc       180
     cgcgtgattg ccgtagtacc ggataccaat cctgccgatc agtccggcga aggcgaaccg       240
     aacgagaccg aagtggccgc cggggtgagc gcgaatcgcg ataatccggc cgtcgatttg       300
     accgacggcc cgaacgatcc gaacgattcc aacctgaacg cccaagtgcg attcggcgcg       360
     gacgccggtg ccggtgagat tatcatcttg cgtccgcgcg gtggccttat caaccacccg       420
     gatacgctgg ttatcccgct gcttgtgccg gatgcgcctg tagtggcgtg gtggccgacc       480
     acaccgccgt cgaacccggc caaggatctg atgggtgcga tggcccgcag tcgcatcacc       540
     gacgcgctgc actccaataa tccggaggcc acgatcgagc gtttgcgccg caattggaca       600
     ccggaagaca tcgacttgtc ctggacacga ctgaccgtct ggcgcgcaat gctcgcctcg       660
     atgctcgatc agccgccgca cctacccatc accgccgtga aggtgaccgg caaggccgac       720
     ttcctgcctc tggaaatgct gtgcgcatgg ctgcgtctga aactcggcgt accagtcgaa       780
     actgagttcg tgcccgacgc gcaggccgtg accggcgtgt acctgacccg tgaggacggt       840
     gtgatctcac tggaacgccc gtatgaggac caagcgctga tctcgctgcc cggccagact       900
     ccgcaggaag tgtccgtgcc gatgcgcacc atcgaggact gtctgaccga ggaactgcgc       960
     cgcatcgatc ccgatgagat ctacgccgag gtcatcaacg aaggctggga tctgattcgt      1020
     cactga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page