(data stored in ACNUC30630 zone)

EMBL: CP002010.PE218

CP002010.PE218       Location/Qualifiers
FT   CDS_pept        300417..301244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0229"
FT                   /product="alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99717"
FT                   /db_xref="GOA:D6ZXS1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS1"
FT                   /protein_id="ADG99717.1"
FT                   /translation="MTAYMEHKDLTNEVIERGRANEIADGVHRVLDRIAESESVAGREA
FT                   GSVHLLAATKTRDVGEILAAIDAGVHRIGENRPQEIVVKAPGLARLLAERGYSLGVVET
FT                   EGGAAADAAHHIPFHLIGQLQANKIGKVLPAVDTIESVDSIELAEKIARRATMRGITVG
FT                   VLLEVNESGEESKSGCAPSHAIDLAQRIGAMGGLHLQGLMTIGAHVDDERTIRAGFAHL
FT                   RRTRDQILASGAEGTADCTELSMGMTHDMAYAIEEGSTIVRVGTAIFGERAFI"
     atgacggcat acatggagca taaggacctg acgaacgagg tcatcgagcg cgggcgcgcg        60
     aatgagatcg ccgatggcgt gcatcgggtg ctcgaccgta tcgccgaatc cgaatcagtc       120
     gccgggcgtg aagccgggtc agtgcatctg ctggccgcca ccaaaacccg tgatgtaggg       180
     gagattctgg ctgcaatcga tgctggtgtt catagaatcg gcgaaaaccg gccgcaggag       240
     attgtcgtca aagcgccggg actggcccgg ctgctggccg aacgcgggta ttcattgggc       300
     gtggttgaga ccgagggagg tgccgcggcc gatgctgccc accacattcc cttccacctc       360
     atcggccagt tgcaagccaa taaaatcggc aaggtgctgc cggcggtgga caccatcgaa       420
     tccgtggatt ccatcgaact ggcggagaag atcgcccgcc gcgccaccat gcgcggcatc       480
     acggtcggcg tgttgctgga ggtgaacgaa tccggcgagg aatcgaagtc cggctgcgca       540
     cccagccacg ccatcgactt ggctcagcgc atcggtgcga tgggcggact gcacttgcag       600
     ggattgatga ctattggtgc ccatgtggat gatgagcgca cgattcgtgc gggcttcgcg       660
     catctgcgcc gcactcgtga ccagattctt gcctccggtg ccgaaggcac ggccgactgc       720
     accgaactgt caatgggcat gacccacgac atggcctacg ccatcgaaga aggctccacc       780
     atcgtgcgcg tcggcaccgc catcttcggc gagcgcgctt tcatctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page