(data stored in ACNUC30630 zone)

EMBL: CP002010.PE22

CP002010.PE22        Location/Qualifiers
FT   CDS_pept        complement(28611..31274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0024"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99521"
FT                   /db_xref="GOA:D6ZX75"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX75"
FT                   /protein_id="ADG99521.1"
FT                   /translation="MPPALTIHYGSATYAPNPARTTTIGRAPDCDLVIHNPYVSHHHAR
FT                   VTFTDDGWLLEDTGSANGLSINGIHTTSVLLLNSTKVTLAQGATIVCIVGTSGPSTPAQ
FT                   PPRRPAANVAQPALPPAPSAQPAQPTQLAPQQARPVVQPTPPAPQPAQPVQPQPTPAPL
FT                   APHRVSPALAHLQQQPRPTAVAPTAVSPVPVSPASPSPSPCASTSPSNAAGTVLAGSTQ
FT                   AVRLESQLTTNRVHGSFSPEHDTTGVIGRDTACLIRINDYLVSRKHCSLETTSSGILLT
FT                   DLNSANGTYVNGRRVAKIWLREDDVVTVGNTDLIVHEGVLCDRTPFVSNDAVIAENIGL
FT                   TVGKGTRLLDGINAVFAKGTLTAVIGPSGAGKSTFTSIVAGLNSPTDGRVLFDGYDVHQ
FT                   NIELLRSRIGFVPQDDVVHRKLSVDAALEYAAKLRLPGSTKAERAEIIDNVLNELELTS
FT                   RRKNRIDRLSGGQRKRVSTAIELLTEPELLILDEPTSGLDPALDLTVMTMLRQLADAGR
FT                   VVIVVTHSLSYINKLCDNVLMLAPGGHPAFFGTVQEMSQAFNGKEWADIFNDVAESPER
FT                   VYSITDSCQRTMQAESTITRHTEHEKPAKPFRIKQTITLVIRQLHLIIADPGLLIFLLL
FT                   LPLLLGLLSLVVPGSHGLGEPDFKDAATEPNQLLVLVILGACFMGSALSVRDIVSERAI
FT                   YGRERAVGLSPTSYTASKLIVMGLQTLLQAAILTTAVSLGKPGPDHGVVTDSGIPELVL
FT                   AIWLTAWTSALLGEVGSALVKSGEQTMPLLVVLVMAQLVFSGGMIPVTGRDSLELVSMI
FT                   FPGRWGFSAAASDIGLNDLLYGPTKVPMFKKDDLWEHTTDQFWFNIGILGIMVVVFTIV
FT                   LRICVSNAVAKMRRRS"
     atgccacctg cccttactat tcactacgga tccgccacct atgcccccaa tcctgcacgt        60
     accacgacca tcgggcgtgc gccggattgc gatctggtga ttcacaaccc gtacgtatct       120
     caccatcatg ctcgcgtcac ctttaccgac gatggttggc tcttggaaga cacgggtagt       180
     gcaaacggac tgtccatcaa cggcattcac accacttccg tactgctgct gaacagcacc       240
     aaagtgacgc tggcacaagg tgccaccatc gtctgcatcg tcggaaccag cgggccgtcc       300
     acgccggcac agcccccgcg acgccctgcg gcaaacgtgg cccagcctgc gctaccgccg       360
     gcaccatcag cgcaaccggc acaacccacg caactcgcgc cgcaacaggc acgcccagta       420
     gtgcaaccca caccaccagc accgcaaccg gcacaaccgg tacaaccgca accaacgcca       480
     gccccgctgg ccccgcaccg cgtatccccg gccctcgcgc acctgcaaca gcaaccccgc       540
     ccaacagcag tggcaccgac ggcagtatcg ccagtgccgg tatcacccgc atcaccatct       600
     ccgtctccct gcgcatccac ttccccatcg aatgccgccg gcaccgttct ggcaggcagc       660
     acgcaagcgg taaggctcga atcccaactc accaccaacc gcgtgcacgg gtccttcagc       720
     cccgagcacg acaccacagg cgtcatcggc cgcgataccg cctgcctgat tcgcatcaac       780
     gattatctgg tctcccgcaa acactgctcg ctggaaacca ccagcagcgg catcctgctc       840
     actgacctga actccgccaa cggcacttac gtcaacggcc gccgcgtcgc gaagatctgg       900
     ctgcgggaag acgacgtcgt caccgtcggc aacaccgacc tgatcgtgca tgaaggcgtg       960
     ctgtgcgacc gcacgccgtt tgtcagcaac gacgcggtta tcgccgaaaa catcggactg      1020
     accgtgggca aaggcacccg gctgcttgac ggcatcaacg ccgtattcgc caagggcacg      1080
     ctcaccgccg taatcggacc ttccggcgcc ggcaaatcaa cattcacctc catcgtcgcc      1140
     gggctcaaca gccccacgga cgggcgcgtg ctgtttgatg gatacgacgt gcatcagaac      1200
     atcgaactgt tgcgcagccg tatcggattc gtgccgcagg acgacgtggt gcaccgcaag      1260
     ctctctgtgg acgcggcgct cgaatacgcc gccaagctgc gcctgcccgg ctcaaccaag      1320
     gccgagcgcg ccgaaatcat cgacaacgtg ctcaatgagc tggaactcac gtctcgccgt      1380
     aagaatcgca ttgacagact gtccggcggc caacgcaagc gcgtgtccac cgctatcgag      1440
     ctactcaccg aacccgaact gctgattctc gacgaaccga cctcgggcct cgacccggcg      1500
     ctggatctta cggtgatgac catgttgcgc caactggcgg atgccggccg cgtggttatc      1560
     gtggtcaccc attcactgtc gtatatcaac aagttgtgcg ataacgtgct catgctcgct      1620
     cccggcggcc atccggcatt cttcggcacc gtgcaggaga tgagccaggc gttcaacggc      1680
     aaggaatggg ccgacatctt caacgatgtc gccgaatctc cggaacgggt gtattcgatt      1740
     actgattcat gccagcgcac catgcaggcc gagtccacca tcacgcggca caccgagcat      1800
     gagaaaccgg caaagccatt ccgcatcaaa cagaccatca ctctggtgat tcgtcagctg      1860
     catttgatca tcgccgaccc cggattgctg atcttcctgc tgttgctgcc attgctccta      1920
     ggactgctgt cgctggttgt gcccggttct catggcttgg gtgagcccga tttcaaagac      1980
     gccgccaccg agccgaacca gctgcttgtg ctcgtcatac tgggtgcctg ttttatggga      2040
     tcggctttgt ccgtgcgaga catcgtctcc gagcgagcga tttacggccg cgagcgcgcg      2100
     gtgggtttgt cgcccacgtc atacaccgcc tcgaaactca tcgtgatggg tttgcagacc      2160
     ttgttgcagg cggcgattct gaccactgcg gtcagcctcg gcaagcccgg cccggaccat      2220
     ggtgtggtca ctgattccgg catacccgaa ctggtgttgg cgatttggct gactgcgtgg      2280
     acttccgcat tgttgggcga agtcggctcg gcgttggtga agtcgggaga acagacgatg      2340
     ccattgctgg tggtgctggt catggcccag ttggtgttct ccggcggcat gattccggtc      2400
     accggccgcg acagcctcga gctggtcagc atgatcttcc ccggacgttg gggcttctcc      2460
     gccgccgcct cggatatcgg gctcaacgat ctgctgtatg gccccaccaa ggtgccgatg      2520
     ttcaaaaagg atgatctgtg ggagcacacc acggatcagt tctggttcaa cattggcatt      2580
     ctggggatta tggtagtcgt cttcaccatt gtgctgcgta tttgcgtcag caatgccgtg      2640
     gccaagatgc gtcggcgctc atag                                             2664
//

If you have problems or comments...

PBIL Back to PBIL home page