(data stored in ACNUC30630 zone)

EMBL: CP002010.PE221

CP002010.PE221       Location/Qualifiers
FT   CDS_pept        complement(303741..304223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99720"
FT                   /db_xref="GOA:D6ZXS4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS4"
FT                   /protein_id="ADG99720.1"
FT                   /translation="MPTVLAKPTQPAAPITPGAAPVAAPGATSTTMNEQQKKIFIIVGA
FT                   VAGFLVLFGIVYGVLSSAVFSAKSVANSYVAAISSGNYDKANTIADPHVNTNQRALLTS
FT                   KASSGENTRITNARISQTSNNADGTVSAQLTYTLEGKEVNGNFTIKDNKVSVEFSE"
     atgcccaccg ttttggccaa gcccacgcag cccgcggctc ccatcactcc cggagcggca        60
     ccggtagccg cacctggcgc gacctccacc accatgaatg agcaacagaa gaaaatcttc       120
     atcatcgttg gtgccgtggc cggcttcctc gtgctgttcg gtatcgtgta tggcgtgctg       180
     tcttccgccg tgttcagcgc gaagagcgtt gcgaacagct atgtggccgc catctcctcc       240
     ggcaactacg acaaggccaa caccatcgcc gatcctcacg tgaatacgaa ccagcgcgca       300
     ctgctgacca gcaaggcatc ctcgggcgag aacacgcgca tcaccaacgc gcgcatctcg       360
     cagacctcca ataatgccga tggcaccgtg agcgcccagc tgacgtacac gcttgaaggc       420
     aaggaggtca acggcaactt caccatcaaa gacaataagg tcagtgtcga gttctccgag       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page