(data stored in ACNUC30630 zone)

EMBL: CP002010.PE224

CP002010.PE224       Location/Qualifiers
FT   CDS_pept        305452..305700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0235"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99723"
FT                   /db_xref="GOA:D6ZXS7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS7"
FT                   /protein_id="ADG99723.1"
FT                   /translation="MSRKRPQPPVKPFKKKPNPLKAAKVTEIDYKDVALLRKFISDRGK
FT                   IRSRRITGVTVQEQRELSKAIKNAREMALLPYATSGR"
     atgtcacgta agaggccgca accgccggtc aagccgttca agaagaagcc gaacccgctg        60
     aaggccgcca aggtcaccga gatcgattac aaggacgttg cgctgctgcg taagttcatt       120
     tccgatcgcg gcaagatccg ttcccgtcgt atcaccggcg tgaccgtgca ggagcagcgt       180
     gagctgtcca aggcgatcaa gaacgcccgc gagatggccc tgctgccgta cgccacctcg       240
     ggtcgctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page