(data stored in ACNUC30630 zone)

EMBL: CP002010.PE228

CP002010.PE228       Location/Qualifiers
FT   CDS_pept        308726..309460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0240"
FT                   /product="MIP family channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99727"
FT                   /db_xref="GOA:D6ZXT1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT1"
FT                   /protein_id="ADG99727.1"
FT                   /translation="MDYPLFTKLAAEFFGTAILMIFGNGSVANVELKNTKGHHAGWLNI
FT                   AMGYGFGVMFPVLMFGSVSGAHINPAMTIAQAVNGLFPWSDVLPYIVAQLLGALLGQLI
FT                   VYITYYPHYKETEDAEAILGTFCTTDADNQKANYFLNEMFGTLVLVFGALCCLSLAWGK
FT                   QDYAAASIVVGFIVWGLVTSMGGPTGPGLNPARDLMPRLLHAILPIPHKGSSRWGEAWI
FT                   PVVAPIVGAIIGAWLFVFFFAN"
     gtggattatc ctctctttac caagctggcc gccgagttct tcggcaccgc cattctgatg        60
     atcttcggca acggctccgt ggccaacgtt gagctcaaga acaccaaggg ccaccacgcc       120
     ggctggctga acatcgccat gggctacggc ttcggcgtca tgttcccggt gctcatgttc       180
     ggtagcgtct ccggcgcgca catcaacccg gccatgacca tcgcccaggc cgtcaacggc       240
     ctgttcccgt ggagcgacgt gctgccgtac atcgttgccc agctgctcgg cgccctgctc       300
     ggccagctca tcgtctacat cacttactac ccgcactaca aggagaccga ggacgccgag       360
     gcgattctgg gcaccttctg caccactgac gcggacaacc agaaggccaa ctacttcctc       420
     aacgagatgt tcggcaccct ggtgctcgtc ttcggcgccc tgtgctgcct gtccctggct       480
     tggggcaagc aggattacgc cgccgcctcc atcgtcgtcg gcttcattgt gtggggcctc       540
     gtgacctcca tgggtggccc gaccggccct ggcctgaacc cggcccgcga cctcatgccg       600
     cgtctgctgc acgccatcct gccgatcccg cacaagggct cctcccgctg gggcgaggcc       660
     tggatcccgg ttgtggcccc gattgtcggc gccattatcg gcgcttggct gttcgtgttc       720
     ttcttcgcca actga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page