(data stored in ACNUC30630 zone)

EMBL: CP002010.PE240

CP002010.PE240       Location/Qualifiers
FT   CDS_pept        322526..322840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99739"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU3"
FT                   /protein_id="ADG99739.1"
FT                   /translation="MSAEDLDNYETDAELALYREYRDVIKLFTYVVETERRFYLANKVD
FT                   FNVRSAGQDVYFDVQLTDAWVWDVYRSSRFVKSVRIVTFKDVNVEEVQKTDIDIPDDIH
FT                   "
     atgagtgccg aggatctcga caattacgaa accgacgccg aactcgcgct gtatagggaa        60
     tatcgtgacg tcatcaagct gttcacctat gtggtggaga ctgagcgtcg cttctacttg       120
     gcgaataagg tcgatttcaa cgtgcgttcc gctggccagg acgtgtattt cgatgtgcag       180
     ctgactgacg catgggtatg ggatgtctac cgttccagcc gtttcgtcaa gtccgtgcgc       240
     atcgtgacct tcaaggacgt gaacgtcgaa gaagtccaga aaaccgatat cgacattccc       300
     gacgatattc actga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page