(data stored in ACNUC30630 zone)

EMBL: CP002010.PE262

CP002010.PE262       Location/Qualifiers
FT   CDS_pept        350824..352296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0275"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99761"
FT                   /db_xref="GOA:D6ZXW5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW5"
FT                   /protein_id="ADG99761.1"
FT                   /translation="MADNQTTAAEPTNGRVTRVQGSVIDVEFPVGHLPDIYNALKVTIV
FT                   NTGAKEEGEAKETEITLEVEQHLGDSTVRCVALKPTDGLVRGASVSDTGAPISVPVGDV
FT                   TKGHVFDVSGNILNKKPDETITVSERWPIHRNPPAFDQLESKTQMFETGIKVIDLLTPY
FT                   VQGGKIGLFGGAGVGKTVLIQEMIQRVAQNHGGVSVFAGVGERTREGNDLIGEMAEAGV
FT                   LEKTALVFGQMDEQPGTRLRVPLTALTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVST
FT                   LLGRMPSAVGYQPNLADEMGSLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHL
FT                   DATTELSRDIASKGIYPAVDPLSSTSRILDPRYVGQAHYDCANRVKAILQRNKELQDII
FT                   ALIGIDELGEEDKTTVNRARKIEQFLGQNFYVAEKFTGRPGSYVPADETIEAFTRICDG
FT                   VYDDVPEQAFSGIGGIDDLEEKWHNMQKELGA"
     atggctgaca accagaccac tgcggccgag cctaccaacg gtcgcgtcac ccgcgtccag        60
     ggctcggtta tcgacgttga attcccggtg ggtcatctgc ccgacatcta caacgccctg       120
     aaagtaacga tcgtcaacac cggcgccaag gaagaaggcg aggcgaagga gaccgagatc       180
     accctcgagg tcgaacagca cctcggtgat tccacggtcc gttgcgtcgc tctgaagccc       240
     accgacggcc tggtccgtgg tgcctccgtc tccgacaccg gcgccccgat ctccgtgccg       300
     gtcggcgacg tgaccaaggg ccacgtcttc gacgtgtccg gtaacatcct caacaagaag       360
     ccggatgaga ccatcaccgt ctccgagcgt tggcctatcc accgcaaccc gccggccttc       420
     gatcagctgg agtccaagac ccagatgttc gaaacgggca tcaaggtcat cgacctgctg       480
     accccgtacg tgcagggcgg caagatcggt ctgttcggtg gtgcaggtgt gggcaagacc       540
     gtgctgattc aggaaatgat tcagcgcgtg gctcagaacc acggtggcgt gtccgtgttc       600
     gcgggcgtcg gcgagcgtac ccgtgagggt aacgatctga tcggcgaaat ggccgaggcc       660
     ggcgtgcttg agaagaccgc actggtcttc ggccagatgg atgagcagcc gggtacccgt       720
     ctgcgtgtcc cgctgaccgc actgaccatg gcagagtact tccgtgacgt gcagaaccag       780
     gacgtgctgc tgttcatcga caacatcttc cgcttcaccc aggccggttc cgaggtgtcc       840
     accctgctgg gtcgtatgcc ttccgccgtg ggttaccagc cgaacctggc cgatgagatg       900
     ggttccctcc aggagcgcat cacctcgacc cgtggtcact cgatcacctc gctgcaggcc       960
     atctacgtgc cggccgatga ttacaccgac ccggccccgg ccacgacctt cgcccacttg      1020
     gatgcaacca ccgagctgtc tcgtgacatt gcctccaagg gtatctaccc ggctgtggac      1080
     ccgctgagct ccacctcgcg aatcctcgat ccgcgttacg tgggccaggc tcactacgac      1140
     tgcgccaacc gcgtcaaggc gattctgcag cgtaacaagg agctgcagga catcatcgcc      1200
     ttgatcggta tcgacgagct cggcgaagag gacaagacca ccgtgaaccg cgctcgtaag      1260
     atcgagcagt tcctcggcca gaacttctac gttgccgaga agttcaccgg tcgccccggc      1320
     tcctacgtgc cggccgacga gaccatcgaa gccttcaccc gcatctgcga cggcgtgtac      1380
     gacgacgtcc cggagcaggc gttctccggt atcggcggca tcgatgatct cgaagagaag      1440
     tggcacaaca tgcagaagga actgggtgcg tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page