(data stored in ACNUC30630 zone)

EMBL: CP002010.PE28

CP002010.PE28        Location/Qualifiers
FT   CDS_pept        36928..37926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0030"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99527"
FT                   /db_xref="GOA:D6ZX81"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX81"
FT                   /protein_id="ADG99527.1"
FT                   /translation="MVTLKDVGELAGVTATTASAALRGKDYVKPETTQRVCDAARKLGY
FT                   KINLSGRSLRSGRSDTITFLTSGLEGDYFSHLAMCVAEEVHKRDSHMLIELSRYLTDDN
FT                   DLSYTFSDGIIAINAPRAVDILKRHPAVMLENYDTSLPIDTVNAPSDAGSRAAIEHLIA
FT                   RGCARIGIVGDNHDPNNPNIIPGSRDIRMRAAKETILAAGLPFDERRDFIKSSWSIDGG
FT                   IEAGRGLAKKGKCKYDGLYCLNDGIALGILRGLADDGVSVPGDVRVIGFDGLSQSMYSV
FT                   PTLTTVATDFKGMADTALTLLMRRIENLDDEFFPQTVNVGYKLIERESTAA"
     atggtgacct taaaggatgt cggcgaactg gccggagtga ccgccaccac cgcctccgcg        60
     gccctgcgag gcaaggatta cgtcaagccc gaaaccacgc aacgcgtgtg tgacgccgcc       120
     cgcaaactcg gctacaaaat caacctgtct ggccggtccc tgcgttctgg gcggtccgat       180
     accatcacct tccttacctc gggcctcgag ggcgactatt tctcccatct ggccatgtgt       240
     gtggctgagg aagtgcacaa gcgcgactcg cacatgctca tcgaactgtc ccggtatctt       300
     accgacgaca acgatctgtc gtacacgttt tcggacggca tcatcgccat caatgcgcca       360
     cgtgcggtcg atatcctgaa gcggcacccg gccgtcatgc tggaaaacta cgacaccagc       420
     ctgcccatcg acaccgtgaa cgcgccgagc gacgccggct cacgggcggc aatcgaacac       480
     cttatcgcgc gtggctgtgc gcgcatcggc atcgtcggcg acaatcacga tcccaacaat       540
     cccaacatca ttcccggctc gcgtgatatt cgtatgcggg ccgccaagga gacgattctc       600
     gcggccggac tgccgtttga cgagcgccgt gatttcatca aatcctcgtg gtcgattgac       660
     ggcggtatcg aggccgggcg cggcttggcc aagaaaggca agtgcaagta cgacggtctg       720
     tactgcctga acgacggtat tgcgctcggt attctgcgtg gtctggcgga cgatggcgta       780
     agtgtgccgg gcgatgtgcg cgttatcggc ttcgacggcc tgagccagag catgtacagc       840
     gtgccgactt tgaccaccgt ggccaccgat ttcaagggca tggcggatac cgcgctgacc       900
     ttgcttatgc ggcgtatcga gaacctggac gacgagttct tcccgcagac cgtgaatgtg       960
     ggctataagc tcatcgagcg cgaatccact gcggcgtag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page