(data stored in ACNUC30630 zone)

EMBL: CP002010.PE287

CP002010.PE287       Location/Qualifiers
FT   CDS_pept        377602..377826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99786"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ0"
FT                   /protein_id="ADG99786.1"
FT                   /translation="MVCTTLNFAEKYLLKTEVRSVAGMSGGTSDAGTDFDVDFGGEGDL
FT                   GSDHATGFNRSLSADDYWAAAGYADESLY"
     atggtgtgca ccacgctgaa tttcgcggag aaatacctgc tgaaaaccga agtcaggtcc        60
     gttgccggta tgtccggcgg tacttccgat gctggtactg atttcgatgt cgatttcggt       120
     ggcgagggcg acctcggaag cgatcatgcc accggtttca atcgctcgct atcggccgac       180
     gattattggg ctgcagccgg atatgccgat gagtcattgt attga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page