(data stored in ACNUC30630 zone)

EMBL: CP002010.PE290

CP002010.PE290       Location/Qualifiers
FT   CDS_pept        378689..378853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0305"
FT                   /product="flagellar FliF M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99787"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ3"
FT                   /protein_id="ADG99787.1"
FT                   /translation="MGLFDSLKNFAADNLGNVLGGDFNLGSIGDLPAVIGEHFNADQLG
FT                   EINRSLATI"
     gtgggactgt tcgatagcct gaaaaatttt gccgcagaca atctaggcaa tgtgcttggc        60
     ggggatttca atcttggttc gattggtgat ttgccggcgg taatcggtga gcatttcaat       120
     gccgatcagt tgggtgaaat caacaggtcg ttggcgacca tttga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page