(data stored in ACNUC30630 zone)

EMBL: CP002010.PE293

CP002010.PE293       Location/Qualifiers
FT   CDS_pept        complement(380503..380874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0310"
FT                   /product="Vacuole effluxer Atg22 like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99792"
FT                   /db_xref="GOA:D6ZXZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ6"
FT                   /protein_id="ADG99792.1"
FT                   /translation="MHHDLDIGTIPRETNLCLCAHQPGSSRSHSCVADHEPHAPPHSTS
FT                   VLTTCVNRMHRHHDSPMISRVPRSHYCFFPKTASIIGTFLVATTTSLTGNASFGVLSIA
FT                   VLLVAALVFLLLQKDPTRN"
     ttgcatcatg accttgacat cgggacaatc ccgcgtgaaa ccaatctctg cctttgcgct        60
     catcagccgg ggagctcacg gtcacactca tgcgtcgcag accacgagcc tcacgcgcct       120
     cctcattcca catctgtgtt aacaacatgt gttaatcgca tgcatcgcca ccatgattcc       180
     ccaatgattt caagggttcc ccggtctcac tattgtttct tccctaaaac ggcctcaatc       240
     atcggcacct tcctggtagc caccaccacg tccctgaccg gcaacgcctc gttcggcgtg       300
     ctctccatcg ccgtcctgct cgtcgcggcg ctggtcttcc tgctgctgca gaaagacccg       360
     acgcgaaact aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page