(data stored in ACNUC30630 zone)

EMBL: CP002010.PE3

CP002010.PE3         Location/Qualifiers
FT   CDS_pept        3600..4838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99502"
FT                   /db_xref="GOA:D6ZX56"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX56"
FT                   /protein_id="ADG99502.1"
FT                   /translation="MHISRLALDHYRSWSQVVVDFVPGVNILFGKNGLGKTNLVEAVEV
FT                   LSTGSSHRTSSTLPLIERGQTTATIRANVADDAGQTTTYEASIHARGANRARINSGSSL
FT                   YLRDIIGKIPSVSFTPEDQRLVSGDPGARRVMMNQAAALLEPGYMQTLQQFTRIAKQRA
FT                   TLLKQLNANANNGQPMDAVLSGLEIWTGQFIEAGVALTRMRAHVIGLLAEPFAAIYADL
FT                   AGAGEQVTLTYAPSFDEVLMFDDPHPQISEHFQRIYPGEMARGVNLIGPQRDDMNLELA
FT                   GIPAREFASNGEMWTMALALKMALFEIVRDRLGLQPIVILDDVFAQLDDSRRTQILDFA
FT                   RKQDQVLITVAAEGDVPDYESAHRIDVATLAEPASVILPTLGNLSDSRENESLGKYDGK
FT                   PAVDSASVERKVS"
     atgcacatct cccgtctcgc actcgaccac taccgctcat ggagtcaagt agtggtcgat        60
     ttcgtaccag gcgtgaatat cctgttcggc aagaatggcc tgggcaaaac taatctggtg       120
     gaagccgtcg aagtgctgtc caccggatcg agtcatcgca cgtccagcac gttgccgctg       180
     atcgaacgcg ggcagaccac ggccaccatc cgcgcgaacg tcgctgatga tgccggtcaa       240
     accactacgt atgaagcgtc gattcatgcg cgtggcgcca accgagcccg catcaactcg       300
     gggtcgtcgc tgtatctgcg cgatatcatt ggcaagattc ccagcgtttc cttcactccc       360
     gaagatcagc gattggtgtc cggcgatccg ggagcacgcc gcgtcatgat gaatcaggct       420
     gcggctctgc tcgagcccgg atacatgcag acgttgcaac agttcacgcg catcgccaaa       480
     cagcgtgcca cattgttgaa gcaattgaat gccaatgcca acaatggaca gccgatggat       540
     gcggttctga gcggtttgga aatctggacc ggccagttca tcgaagccgg tgtggcgttg       600
     acccgtatgc gcgctcatgt gatcggtctg cttgccgagc catttgccgc gatttacgcc       660
     gacttggccg gtgccggcga gcaggtgacg ctcacatatg cgccttcatt cgacgaagtg       720
     ctgatgttcg atgatccaca tccgcagatc agcgagcatt ttcaacgcat ctaccccggt       780
     gaaatggctc gcggcgtgaa ccttatcggt ccgcagcgcg atgacatgaa ccttgagttg       840
     gccggtattc ccgcccgcga gttcgcttcg aacggcgaga tgtggacgat ggcgttggcc       900
     ttgaaaatgg cattgttcga aatcgtgcgt gaccggttgg gattgcagcc gattgtgatt       960
     ctcgatgatg tgttcgccca gcttgacgac agccggcgca cgcagattct tgatttcgcc      1020
     agaaaacagg atcaggtgct gattaccgtg gccgctgaag gcgatgtgcc cgactatgaa      1080
     tcggcccatc gtatcgacgt ggccacactg gccgaacccg cttccgtaat actgccaact      1140
     ctgggcaatt tgtccgattc gcgggaaaac gagagtttgg gtaagtatga cggaaaaccc      1200
     gcggtggaca gcgcgtccgt agaacggaaa gtgtcatga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page