(data stored in ACNUC30630 zone)

EMBL: CP002010.PE300

CP002010.PE300       Location/Qualifiers
FT   CDS_pept        385938..388571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0317"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99799"
FT                   /db_xref="GOA:D6ZY03"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY03"
FT                   /protein_id="ADG99799.1"
FT                   /translation="MSITMDTTLASLVTNKRRVSALKSLGIVTVGDALTYYPFRVTEPV
FT                   PLRAIREAAPGQQMAFAAVIRDMRVVPMNARRGYRLEATVDDADFARSRRVPGSTARLT
FT                   FFSYRKSYVDWVSMRLRAGTSVVVSGMPSEYMGQLQFTHPEILTVAPGSAGAGAGLEGY
FT                   ARGAASGNGAFAGSTDPYASVQSAYPPAAAASSGAALKYDADTVQEALTRVCRPRPVYH
FT                   ASSRISSEHIHETILGLLWMMGARTSSTPDGQLAGAGSAGIVAPTTDTIAVQNGEENSG
FT                   TTAESGAEALSQSIPDVLPESVRKAKNLMHRAEAFLAIHDPASTTRFKEAIETLRYEEA
FT                   FVSQTSLLKARSHAHKSAAHSCPLVTDSLRDQFIASLPFSLTAGQQQVIHDIAADLAHD
FT                   WPMQRLLQGEVGSGKTVVALAAMLQAVDAGYQAVLVAPTQVLAEQHAETIGRMVEQLKP
FT                   AIPVTLLTGGMKLAARRKALAAASSGEPGIIVATHAAFSKTFQAPHLALVVIDEQHRFG
FT                   VEQRESLNAKTDDGTTPHLLVMTATPIPRTAAMTWFGDLDISWLTELPGGRKPIRTVVV
FT                   NEADAATMGRMFAHIRARVDAGERAYIVCPRIDADDEGNEGGSGVSAAAGSARGRAAAS
FT                   GSSARTAAGGRATRAAADAIGIDDPYETFDENGETVARPPLHAVAEIADRLQKLPQFQG
FT                   IRFATLTGRDKDDVKTQVMADFAGGETPILVSTTVIEVGVDVKQASCIVIFDADRYGLS
FT                   QLHQLRGRVGRGGTNSWAFLISRAEPGSPAEQRLEVIHHSLDGAEIAQADLEFRGAGDV
FT                   LGDAQSGGKSSLKLLRVVKDADMIADARTRAEQLLAADPELADEVQLAGAVLDFTRGNE
FT                   TFLTSS"
     atgagcatca ctatggacac cactctcgct tcgctggtca ccaacaagcg tcgcgtgtcc        60
     gcgctcaaat cgctgggaat cgtcactgtc ggcgacgccc tgacctacta tcccttccgc       120
     gtcaccgaac cggtgccgct tcgcgccatc cgcgaggccg cacccggcca gcagatggca       180
     tttgccgccg tgatacgaga catgcgcgtg gtgccgatga acgctcgccg cggctaccga       240
     ctcgaggcga cggttgacga cgccgacttt gcccgttcgc gtcgcgtacc cggcagcacg       300
     gcccggctca cgttcttttc gtatcgtaaa tcgtatgtgg attgggtcag catgcggctg       360
     cgcgccggca cgtctgtggt ggtctccggt atgcccagcg aatacatggg gcagctgcaa       420
     ttcacgcacc ccgaaatcct cactgtcgcg cccgggtcgg ccggagcagg agcggggctt       480
     gagggttacg ctcggggtgc ggcatccggc aatggtgcgt ttgcgggaag taccgatccg       540
     tatgccagtg tgcagtccgc gtatccgccg gccgcggctg cctcttccgg ggccgcgctg       600
     aaatacgacg ccgataccgt gcaagaggcg cttacccgcg tctgccggcc ccgcccggta       660
     tatcacgcca gttcgcgtat ctcgtccgaa catattcatg agacgattct gggattgctg       720
     tggatgatgg gggcccgcac gtcatccacg cctgacgggc aactcgctgg cgctgggtca       780
     gccggcattg tggctcccac gaccgacacc atcgccgtcc aaaacgggga agagaattcc       840
     ggtacgaccg ccgaatccgg tgctgaggcg ctctcccaat ccatcccaga tgtgctgccc       900
     gaatcggtgc gcaaggccaa gaacctcatg catcgggctg aggcgttcct ggccattcat       960
     gatccggcct ccacgacccg gttcaaggag gccatcgaaa ccctgcgcta tgaggaggct      1020
     ttcgtttcgc agacctcgct gcttaaagcc aggtcgcacg cccataaatc cgcggctcac      1080
     tcttgcccgt tggtaaccga cagtctgcgc gatcagttca tcgcatccct gccgttctcc      1140
     ctcactgcag ggcagcagca ggttattcat gatattgccg ccgatttggc tcatgactgg      1200
     ccaatgcagc gtctgctgca aggcgaggtg ggctccggca aaaccgtagt ggcgctcgct      1260
     gccatgctcc aagccgtaga cgccggctat caggccgtgc ttgttgcccc gactcaggtg      1320
     ctggccgagc agcatgccga aaccattggc cggatggtgg agcaactcaa gccagcgatt      1380
     ccagtcacgt tgttgacggg cggcatgaag cttgctgcgc gacgtaaagc acttgctgcg      1440
     gcgtccagtg gcgagccggg cattatcgtg gccacgcacg cggcgttttc caagaccttt      1500
     caagccccgc acttggcctt ggtggtaatc gacgagcagc accggttcgg tgtggaacag      1560
     cgcgaaagtc tcaacgccaa aaccgatgac ggcaccacgc cgcatctatt ggtgatgacc      1620
     gccacgccca tcccgcgcac tgccgccatg acttggtttg gcgatctcga tatttcctgg      1680
     ctcaccgaat tgcctggcgg ccgcaaaccg attcgcaccg tggtggtcaa tgaggccgac      1740
     gccgccacca tgggccgtat gttcgcgcac attcgcgcgc gagtcgacgc gggggagcgg      1800
     gcctatatcg tgtgcccgcg cattgatgcg gatgatgagg ggaacgaagg cggttccggc      1860
     gtttcggcag cagccggttc tgcccgcgga cgcgccgcag catctggttc cagtgcccgc      1920
     acagctgcgg gcggccgtgc aacgcgcgcg gcggccgacg ccatcggcat cgacgacccc      1980
     tacgaaacct tcgacgaaaa cggcgaaacc gtggctcgcc cgccattgca tgcggtggcc      2040
     gaaatcgccg accggttgca gaaactcccg caattccaag gcattcggtt tgcgactctg      2100
     accggccgcg acaaggatga cgtcaaaacc caggtcatgg ccgattttgc cggcggcgag      2160
     actccgattc tggtgtccac cacggtgatc gaagtcggcg tggacgtcaa gcaggccagc      2220
     tgcatcgtga tctttgatgc cgaccgatac ggcctctctc agttgcatca gctgcgcggc      2280
     cgcgtggggc gtggcggcac caactcgtgg gcgttcctta tttcccgtgc ggaacccggc      2340
     tccccggccg agcaacggct cgaagtgatt caccactcgc tcgacggtgc cgaaatcgcc      2400
     caagccgact tggaattccg cggtgccggc gatgtgctcg gcgacgccca atccggcggc      2460
     aagtccagcc tgaagctcct gcgcgtggtc aaggacgccg acatgatcgc cgacgcccgc      2520
     acccgtgccg agcagcttct ggctgccgac cccgaactgg cagacgaggt ccaactcgcc      2580
     ggtgccgtcc tcgacttcac ccgaggcaac gaaaccttcc tgacctccag ctga            2634
//

If you have problems or comments...

PBIL Back to PBIL home page