(data stored in ACNUC30630 zone)

EMBL: CP002010.PE322

CP002010.PE322       Location/Qualifiers
FT   CDS_pept        413164..413751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0339"
FT                   /product="Resolvase, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99821"
FT                   /db_xref="GOA:D6ZY25"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY25"
FT                   /protein_id="ADG99821.1"
FT                   /translation="MRVREWARREGFNEQTVWQWCRENRMPVPFERMNTGTIIIHDPKY
FT                   ENQPAAPTANGRTVCYARVSSSDQKDDLQRQADRLKAFAINMGVKSPEVVTETGSGMND
FT                   KRRKLNRLLSDPTVGTLVVERRDRLARMNMGLVESALKAQGRRIIVVDDTEPDDDLVRD
FT                   MAEALTSFCARLYGSRAAKRKTDAALRAARDA"
     atgcgtgtca gggaatgggc gaggcgtgag ggcttcaacg agcagacggt gtggcagtgg        60
     tgtcgcgaga accgtatgcc cgtcccgttc gagcgcatga acacgggcac gattatcatc       120
     cacgacccga aatacgagaa ccagcccgcc gcccccacag cgaacggcag gacggtgtgt       180
     tacgcgcgtg tcagctcgtc cgaccaaaag gacgatttgc aacgtcaggc cgaccggttg       240
     aaggcgttcg ccatcaacat gggcgtcaag agccccgagg tggtcacgga gaccggctcg       300
     ggcatgaacg acaagcggcg caagctcaac cggctgttgt ccgacccgac cgtgggcacg       360
     ctggtcgtgg agcgcaggga caggctcgcc cgcatgaaca tgggactggt ggagagcgcg       420
     ttgaaggcgc agggacgccg aatcatcgtg gtggacgaca cggagccgga tgacgatctg       480
     gtgcgtgaca tggccgaggc gctgacctcg ttctgcgccc ggctgtatgg gagtcgcgcg       540
     gccaagcgca agacggacgc ggcgttgagg gcggcgcgcg atgcttga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page