(data stored in ACNUC30630 zone)

EMBL: CP002010.PE329

CP002010.PE329       Location/Qualifiers
FT   CDS_pept        421450..422403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0346"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99828"
FT                   /db_xref="GOA:D6ZY32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY32"
FT                   /protein_id="ADG99828.1"
FT                   /translation="MSSQDKTAVQPVGGKTADKVFRGVAYACGILILVVLAAVFLFLFF
FT                   RAWPLIGGDQAANSDTVSSFTGGKASSFWGYVLPLLFGTVLVSLLALLIAFFVSIGIAL
FT                   FISHYAPKKLATALSYVVDLLAAIPSVIYGLWGGLILVPAIYPFWNWVANHLGFIPLFE
FT                   GPAANPSRTVATVAVVLAVMILPIITSMSRDIFMQTPRLHEEAALALGATKWEMIRLAV
FT                   LPFGKSGIVSASMLALGRALGETMAVLMILSPGLNYSIKLLQASQNQTIAANIAAQYPE
FT                   ANDLGVSTLIGTGLILFLITFVVNFIARKLTEKATA"
     gtgagttcgc aagacaaaac ggctgtgcag ccagttggag gcaagaccgc cgacaaggtg        60
     tttcgcggtg tggcatacgc ctgcggcatc ctgatcctgg ttgtacttgc cgctgtgttc       120
     ctgttcctgt ttttccgcgc ctggccactc atcggtggcg atcaggccgc caacagcgac       180
     accgtgtcca gctttaccgg cggcaaggcc agcagcttct ggggctacgt gctcccgctg       240
     ttgttcggta ctgtgctcgt gtctttgctg gcactgctga ttgccttctt cgtgtccatc       300
     ggcattgcgc tgttcatttc gcactatgca cctaagaagc tcgccaccgc gctgagctat       360
     gtggtcgatc tgctggctgc catcccgtcc gttatctacg gtttgtgggg cggcctgatt       420
     ctggtgccgg ccatctaccc gttctggaac tgggttgcca accacctggg cttcattcca       480
     ctgttcgagg gcccggccgc caacccgtcg cgcaccgtcg ccaccgtggc tgtggtgctc       540
     gccgttatga ttttgccgat tatcacctcc atgtcccgcg atatcttcat gcagaccccg       600
     cgcctgcacg aagaggccgc gctggcgctc ggcgccacca agtgggagat gattcgtctg       660
     gccgtgctgc ctttcggcaa gtccggtatt gtgtccgcct ccatgctggc tctcggccgc       720
     gcgcttggtg agacgatggc cgtgttgatg atcctgtccc cgggcctcaa ctactccatc       780
     aagctgctgc aggcctcgca gaaccagacc atcgccgcga atattgccgc acagtaccct       840
     gaagccaacg atctgggcgt ctccacgctg attggaaccg gtctgattct gttcctgatc       900
     acgttcgtgg tcaacttcat cgcccgtaag cttaccgaga aagcgactgc gtga             954
//

If you have problems or comments...

PBIL Back to PBIL home page