(data stored in ACNUC30630 zone)

EMBL: CP002010.PE33

CP002010.PE33        Location/Qualifiers
FT   CDS_pept        complement(50550..51536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99532"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX86"
FT                   /protein_id="ADG99532.1"
FT                   /translation="MGSSTALTELTMQKYQRMQTCADVQRRSAWRPPYALTTALELLSI
FT                   EVPRISSKHRGLATTTIVAVPHANDKRHIVGVKVVVWPFPLDTVIIEGQFTCTSPACTW
FT                   AMFSAYLELEELIVLADSMMRRDRRLCRTTIDALSLYLDEAEAQVRANKENGANSYLFR
FT                   GYNKCRRALLLARAGTDSSMETRTRLVLLKYGLDCPQVNYPIFVGNNTRPIYLDLAYPE
FT                   FKVCIEYEGSHHAGQWLNDARRRQMIEDAGWKYIQVTKLDIGNEAGEEALARRVAERIQ
FT                   EVTGKTVQLTMRQTTQQISDVRKLRRIPLYKRLKFEPLLPIIPTTQE"
     atgggtagct caacggcatt gaccgagctg acaatgcaga agtatcaacg aatgcagacg        60
     tgcgcagatg ttcaacgacg aagcgcatgg cgcccaccct atgccctgac aacagcgttg       120
     gagcttttgt caattgaagt accccgcata tcaagcaaac acagaggcct tgcaactaca       180
     accattgttg cggttccaca cgccaatgac aaacggcaca ttgtgggggt caaagtggtt       240
     gtatggcctt ttccactaga cacggtcata atcgagggac aattcacatg cacttcacca       300
     gcttgcacat gggccatgtt ctccgcgtat ctcgaacttg aagaactcat cgttctcgct       360
     gattccatga tgcgacgaga tcgaaggctc tgcagaacaa ccatcgacgc cctttctctg       420
     tatctcgatg aggccgaggc ccaggtgcga gccaacaaag agaatggagc caattcgtat       480
     ttgttccgcg ggtataacaa atgccgtcgc gccctgcttt tggcgcgcgc gggcacagat       540
     tcctccatgg aaacacgaac tcgtttggtt ctcttgaaat acggtctgga ttgcccgcag       600
     gtgaattatc caatattcgt aggaaacaac accagaccca tatatctcga tcttgcatac       660
     cctgaattca aggtatgcat cgaatacgaa ggctctcatc atgccgggca atggctgaat       720
     gacgcgagac gccgccagat gatcgaagac gctggctgga agtacattca agtcaccaaa       780
     ttagatattg gcaacgaagc gggagaagag gcccttgccc gaagagttgc cgaaaggata       840
     caggaggtta cgggcaaaac ggtccagctc acgatgcggc aaaccaccca gcaaattagc       900
     gatgtccgaa agctacgccg tattccgctg tacaaacggc tgaaattcga gcctctgctg       960
     ccaattattc cgacgacgca ggaataa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page