(data stored in ACNUC30630 zone)

EMBL: CP002010.PE331

CP002010.PE331       Location/Qualifiers
FT   CDS_pept        423454..424233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0348"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99830"
FT                   /db_xref="GOA:D6ZY34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY34"
FT                   /protein_id="ADG99830.1"
FT                   /translation="MGQRIDVNHENIYYGDFLAVEDVNINIEPNKVTAFIGPSGCGKST
FT                   VLRTLDRMHEIIPGAHVEGEVLLEGKNLYDKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVRLNNHHLAKSDADDLVEWALRGANLWEEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLINELKSDYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFADTITMFNNPQNEEAERYISGRFG"
     atgggacaac gtattgacgt caaccacgag aacatctatt acggcgactt tctggccgtg        60
     gaagatgtga acatcaacat cgagccgaac aaggtcaccg ccttcatcgg cccgtccggc       120
     tgcggcaagt ccaccgtgct gcgcaccttg gaccgtatgc acgagatcat ccccggcgct       180
     cacgtcgagg gcgaggtgct gctcgaaggc aagaacctgt acgacaagga cgtggatccg       240
     gtggccgtgc gccgcgacgt cggcatggtc ttccagcgcc cgaacccgtt cccgaccatg       300
     tccatccgtg agaacgtgct ggccggtgtg cgcctgaaca accaccacct ggccaagtcc       360
     gacgccgacg atctggtcga gtgggctctg cgcggtgcca acctctggga agaggtcaag       420
     gaccgtcttg acaaccctgg catcggcttg tccggtggcc agcagcagcg tctgtgcatc       480
     gcccgcgccg tggccgtcca cccgcaggtg ctactcatgg atgagccctg ctccgccttg       540
     gacccgattt cgaccttggc tgtcgaggat ctgatcaacg agctcaagag cgactacacc       600
     atcgtgatcg tgacccacaa catgcagcag gccgcccgta tcgccgacta caccgccttc       660
     ttcaacctga aggcagtggg ccagcccggt cacctcgagt acttcgcgga caccatcacg       720
     atgttcaaca acccgcaaaa cgaagaagcc gagcgctaca tctctggaag gttcggctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page