(data stored in ACNUC30630 zone)

EMBL: CP002010.PE335

CP002010.PE335       Location/Qualifiers
FT   CDS_pept        427955..429757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99834"
FT                   /db_xref="GOA:D6ZY38"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY38"
FT                   /protein_id="ADG99834.1"
FT                   /translation="MEYSHHRKTNSIKFTVSFTMHDVATKWKDVATFQWEPFGENNQVP
FT                   IGTVTGTVHFPKGVTASNSWTWLHTEQTSETGRTKDGSFTFTVNDVKSGEYLDVVAAFD
FT                   AAKAGDMARVETDDHLQELKEDEADDERFWRNLERQRATRRLNNWMTTISAGLIFGSIG
FT                   VVAALRFPGRSRYRGSIEYWRDRPELSPASAAKLIDIVTSGDKPDISERQLVATLLSLA
FT                   VKKVIAVFPGSADLYIGVDLKQVSPVELSQRIGSDPYKRNNARTNSTIVMLWQSDYGVS
FT                   EGFDESVFVESVFDGSGSGGSGSAASSVSDAHQPDLSASERALLYLLTVISERVGRTAF
FT                   DMDDIKDACKDWKDGYKELEKFTNACKTEFAAADIAPKTENGWLIPGAITVLIGGASIF
FT                   INGLAGYLVAGALIGIPLMTVGIFCFLMGNSYVLTDHGQQMAGQCLGLKRYMQGFSNFK
FT                   YRGVADLTLWDWYMVYAAAFGISDRVMRELAMAYPQVSDPEWLDANASDTVFYWNYRPY
FT                   DWYGLRFYNGSAFADSVADSGLAGAVPAFGGTSFAAGFSDLGTQLSYGFADITATINAA
FT                   SPSGGSGGFGGSSGGSGGGSFGGR"
     ctggaatatt cccaccaccg taaaaccaac agcatcaagt tcacggtgag cttcaccatg        60
     catgacgtgg ccaccaagtg gaaggacgtg gcgaccttcc aatgggagcc attcggtgag       120
     aacaatcagg tgccgattgg tacggtcacc ggcacggtgc atttccccaa aggtgtgacc       180
     gcgagcaact cgtggacttg gctgcacact gaacaaacct cggaaaccgg ccgaaccaag       240
     gatggcagct tcaccttcac cgtaaatgat gtgaaaagcg gcgagtacct agacgtggtg       300
     gccgctttcg atgcggccaa ggcgggagat atggctcgtg tcgagaccga cgatcatctg       360
     caggagttga aggaagacga agccgacgac gaacggttct ggcgcaatct ggaacgccaa       420
     cgcgccacaa ggcgcctgaa caactggatg accaccatat cggccggcct gatattcggg       480
     agtattggtg ttgttgcagc cttacgcttc cccggacgtt cacgttaccg tggctccatc       540
     gaatattggc gcgatcgccc cgagctgagc cccgcatcgg cggccaaact catcgatatc       600
     gtgacttccg gcgacaaacc cgacatttcc gagcgccaac tcgtcgcgac cttgctttct       660
     ctggccgtga agaaagtcat tgctgtgttc cccggttcgg cggacctgta tatcggcgtg       720
     gatctgaaac aagtttctcc ggtggagctc agtcagcgaa tcgggtccga tccatacaag       780
     cgcaataatg cgcgtaccaa tagcacgatt gtgatgctgt ggcagtccga ttacggcgta       840
     tctgagggat ttgatgaatc agtattcgtc gaatccgtat ttgatggatc tggatctggc       900
     ggatctggat ctgccgcatc tagtgtgtcc gatgcacacc agcccgatct cagtgcttct       960
     gagcgggcat tgctctatct gctcaccgtg atttccgagc gcgtaggtcg tacggcattt      1020
     gacatggatg acatcaaaga cgcctgcaag gattggaaag acggctacaa ggaactcgaa      1080
     aagttcacca atgcgtgcaa gaccgaattc gcggcggcgg atatcgcgcc gaaaaccgag      1140
     aacggatggc tcattcccgg ggcaatcacc gtgctgatcg gtggcgccag catattcatc      1200
     aacggtttgg ccggatatct ggtggccggg gccctcatcg gcattcccct gatgacggtc      1260
     ggcatattct gcttcctgat ggggaattcc tacgtgctga ccgatcatgg tcagcagatg      1320
     gccgggcaat gtttgggtct caaacgatat atgcaaggtt tctcgaactt caagtaccgt      1380
     ggagtcgcgg atttgacgct gtgggattgg tatatggtct acgctgccgc atttggcata      1440
     tccgatcggg tgatgcggga gctggccatg gcctatccgc aagtatccga tccggaatgg      1500
     cttgatgcca atgcctccga cacggtgttc tattggaatt atcgtccgta cgactggtat      1560
     gggttgcgtt tctacaatgg ctcggcgttc gcggattccg tggctgacag cggattggcc      1620
     ggagcggtgc cagcgttcgg gggcacgtcg ttcgcggctg ggttctctga cctcggcacg      1680
     caattgtcgt acggatttgc ggatatcacc gcgacaatca atgcggcctc gccatccggt      1740
     ggctcaggcg gctttggcgg tagcagcggc ggttccggcg gcggttcgtt cggtgggcgg      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page