(data stored in ACNUC30630 zone)

EMBL: CP002010.PE350

CP002010.PE350       Location/Qualifiers
FT   CDS_pept        complement(443919..445730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0367"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99849"
FT                   /db_xref="GOA:D6ZY53"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY53"
FT                   /protein_id="ADG99849.1"
FT                   /translation="MYRRSAPPHPDLRNNPVKRTQIPFTKPHSATQSPESVVPNTAISR
FT                   VAARLLPIMAAFSSLTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADVALDVVR
FT                   SFTGKVRERALGTEVSDALNPAQQVVKIVNEELTDVLGQGVDRPLNFAKNPPTIIMLAG
FT                   LQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYAPEKGVQ
FT                   SDGGEAVAAPGQTSGDPVKVARDSIELAKQKLYDTVIIDTAGRLGVDEELMKQARDIRD
FT                   AVHPNEILFVIDAMIGQDAVKTAKAFDEGVDFTGVVLSKLDGDARGGAALSVASVTGKP
FT                   ILFASNGEGLKDFEVFHPDRMASRILDMGDIMTLIEQAQKQFDEEEARKAAEKISEGSF
FT                   GLDDFLDQLQQVRKLGSMKSLLGMIPGMAQHRKELEQFDEKEIDRTEAIIRSMTPAERR
FT                   DPSIINGSRRARIAYGSGVTVSQVNALLQRFEQAAKMMKRMSNRGGMGGGIPGFGGPAM
FT                   GGGKKKGKNKKKGGKSGNPMKREAEEKALRDKLAGKSSGSTGGSAFAKKPQNPALPAGL
FT                   EQMMGNVDGGTELPPNLGGGLGGLFGR"
     atgtaccgca gatcagctcc tccacaccct gatctacgca acaatcccgt gaaaaggacg        60
     caaataccgt tcactaagcc ccactccgcg acgcaatccc cggaaagcgt cgtccccaac       120
     accgcaattt cccgcgtggc ggctagactg ttgcccatta tggcagcttt ttcatctttg       180
     acagacagac tctcgaatgc gttcaagcat ctgaagagca agggcaagct ttccgaggcg       240
     gatatcgacg gtacgatccg tgaaatccgc cgcgcgctgc tcgacgccga cgtggcgctc       300
     gacgtggtgc gttccttcac cggcaaggtg cgtgagcgcg cactgggaac cgaggtgtcc       360
     gacgcactca accccgccca acaggtggtg aaaatcgtca acgaggagct caccgacgtg       420
     ctcggccaag gcgtcgatcg tccgctgaac ttcgcgaaga acccgccgac gatcatcatg       480
     ctcgccggcc ttcagggtgc cggtaagacc acgctggccg gcaagctcgg ctactggctc       540
     aaggattccg gccacacgcc gctgctggtg gcggccgatt tgcagcgtcc gaacgcggtg       600
     acgcagctgc aggtggtcgg cgaacgcgcc ggcgtgcccg tctatgctcc cgaaaagggc       660
     gtccaatccg atggcggcga ggccgtcgca gctccgggcc agacctccgg cgacccggtg       720
     aaggtggccc gcgattccat cgaactcgcc aagcagaagc tctacgacac ggtaatcatc       780
     gataccgccg gtcgtctggg cgtggacgag gagctgatga agcaggctcg cgacattcgc       840
     gatgccgtgc accccaacga aatcctgttc gtcatcgacg cgatgatcgg ccaggacgcc       900
     gtcaagaccg ccaaggcctt tgacgagggc gtggacttca ccggcgtggt gctgtccaag       960
     ctcgatggcg acgcccgcgg tggtgccgcg ctgtccgtgg cgtccgtgac cggcaagccg      1020
     atcctgttcg cctccaacgg tgagggcctg aaggatttcg aggtcttcca cccggaccgc      1080
     atggcctcgc gcatcctcga catgggcgac atcatgacgc tcatcgagca ggcgcagaag      1140
     cagttcgatg aggaagaggc ccgcaaggcc gccgagaaaa tctccgaagg ctccttcggc      1200
     ctggacgact tcctcgatca gctgcagcag gtacgcaagc tgggctcgat gaagtcgctg      1260
     ctcggcatga ttccgggcat ggcccagcac cgcaaggaac tcgagcagtt cgatgagaag      1320
     gaaatcgacc gcaccgaggc gattattcgc tcgatgaccc cggccgagcg ccgcgatccg      1380
     tcgatcatca atggttcccg ccgcgcccgt atcgcctatg gttccggcgt gacggtttct      1440
     caggtgaacg ctttgctgca gcgtttcgag caggccgcaa agatgatgaa gcgcatgtcc      1500
     aatcgtggcg gcatgggcgg cggcatcccc ggcttcggcg gcccggctat gggcggcggc      1560
     aagaagaagg gcaagaacaa gaagaaaggc ggcaaatccg gcaatccgat gaagcgcgag      1620
     gccgaggaga aggcattgcg cgacaagctg gccggcaaat cctccggttc gaccggcggt      1680
     tccgccttcg ccaagaagcc gcagaacccg gccctgcccg ccggccttga acagatgatg      1740
     ggcaacgtcg atggtggcac tgaactgccg ccgaacctcg gcggaggcct tggcggactg      1800
     ttcggccgct ga                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page