(data stored in ACNUC30630 zone)

EMBL: CP002010.PE357

CP002010.PE357       Location/Qualifiers
FT   CDS_pept        complement(453162..455129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0374"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99856"
FT                   /db_xref="GOA:D6ZY60"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY60"
FT                   /protein_id="ADG99856.1"
FT                   /translation="MALPTPLQAFSGVPKINAAPDKQTIVDGEKMTGAQALVRSLEDLG
FT                   VEDVFGIPGGAILPVYHEIKDNTKFRFVLMRHEQAAGHAAEGYALATGKVGVCIVTSGP
FT                   GATNVVTAIADANMDSVPMVVITGQVGVQAIGTDAFQEADIVGITYPVSKHSFLVTRAQ
FT                   DIPRVLSEAYYIANTGRPGPVVVDLTKTAQTGDMYYSWPQRMILPGYNPTTKAHGRVLS
FT                   DAAKLFSQSYRPVLYVGGGAARSNAGAQVKALADLTGAPVVTTLPARGIIPDSDPKNLG
FT                   MLGMHGTIAATGAVQRADLLVAIGARFDDRVTGKLDAFAPTARVIHIDIDPAEIGKNRQ
FT                   PDVPIVGDAATVLDDLIPEIQRTQAIQGKPNLAPWWKAIDGWREEYPMTWDEPTDGSMA
FT                   PQWVIKKLSEMADPSTIWVTGVGQHQMWASQFIDFENQHAWISSGGLGTMGYGLPAAIG
FT                   ASVGSAREFEGKKPVWLIDGDGSFQMTSEELAAAFLDHAPVKIAILNNSVYGMVRQWQT
FT                   LFYEHHYSQTNLLDGEAHGADGAAALVDGDAPLEVPDFIKLAEAYGCVGIRAFTEEEAI
FT                   NAIEKANQINDRPVLIDFRVWKDAMVWPMVAAGASNDEVTYKPGIKPLAGGTPAPGTGP
FT                   DEHATGVFEHETAAAAASEH"
     atggctttac ccacgccttt gcaggcattc agcggcgtgc cgaaaatcaa cgcggccccc        60
     gataagcaga ccatcgtcga tggcgagaag atgactggcg cccaagcgct ggtgcgttcg       120
     ctggaggatc tcggcgtcga ggacgtcttt ggcattcctg gcggcgcgat tctgcccgtc       180
     taccacgaga tcaaagacaa cacgaagttc cgcttcgtgc ttatgcgcca cgagcaggcc       240
     gccggccacg ccgccgaagg ctacgcactg gccactggca aggtgggcgt gtgcatcgtg       300
     acttccggcc cgggtgccac gaacgtggtc acggccattg cggacgcgaa tatggactcc       360
     gtgcccatgg tcgtgattac cggtcaggtg ggcgtgcagg ccatcggcac tgacgccttc       420
     caggaggcgg atatcgtggg catcacctac ccggtgtcca agcactcctt cctcgtgacc       480
     cgcgcgcagg acattcctcg cgtgctttcc gaggcgtact acatcgccaa caccggccgc       540
     cccggcccgg tggtcgtgga tctgaccaag accgcacaga ccggcgacat gtactactca       600
     tggccgcagc gcatgattct gcccggctac aaccccacca ccaaggcgca cggccgtgtg       660
     ctgtccgacg cggcgaagct gttctctcag tcgtaccgcc cggtgctgta tgtgggtggc       720
     ggcgccgccc gctccaacgc cggcgcacag gtcaaggctc tggccgacct gaccggcgcc       780
     cccgtggtca cgaccctgcc cgcacgcggc atcattcccg actccgaccc gaagaacctc       840
     ggcatgctgg gcatgcacgg tacgattgcc gcaaccggtg ccgtgcagcg cgctgacctg       900
     cttgtggcca tcggtgcacg tttcgacgac cgcgtgaccg gcaagctcga cgccttcgca       960
     ccgaccgccc gcgtgattca tattgacatc gacccggctg aaatcggcaa gaaccgtcag      1020
     cccgacgtgc cgatcgtggg cgatgcggct accgtgctcg acgacttgat tcccgaaatc      1080
     cagcgcacgc aggccattca gggcaagccg aatctggccc cctggtggaa ggcgatcgac      1140
     ggctggcgcg aggaataccc gatgacgtgg gatgagccga ccgacggatc aatggccccg      1200
     cagtgggtca tcaaaaagct ctctgagatg gccgatccgt ccaccatctg ggtgaccggt      1260
     gtgggacagc accagatgtg ggcttcgcag ttcatcgatt tcgagaacca gcacgcttgg      1320
     atctcctccg gaggcctcgg cacgatgggc tacggtctgc cagccgccat cggcgcatcc      1380
     gtgggctcgg cccgcgagtt cgagggcaag aagccggtgt ggctgatcga tggtgacggt      1440
     tccttccaga tgacctctga ggagctggcc gccgcgttcc tggaccacgc tccggtgaag      1500
     atcgcgattc tgaacaactc cgtgtacggc atggtccgtc agtggcagac gctgttctac      1560
     gagcaccact actcgcagac caacctgctc gatggcgagg cgcacggtgc cgatggtgcg      1620
     gcggcactgg tcgacggcga tgcgccgctc gaagtgcctg atttcatcaa gttggccgag      1680
     gcatacggct gcgtgggcat ccgcgcgttc accgaggaag aggcgattaa cgccatcgaa      1740
     aaggcgaacc agatcaacga ccgcccggta ctgattgatt tccgcgtgtg gaaggatgcg      1800
     atggtgtggc cgatggtagc cgccggcgct tccaacgacg aggtgacgta caagcccggc      1860
     atcaagccgc tggctggcgg caccccggct ccgggaaccg gtccggacga gcatgcgacc      1920
     ggcgtgttcg agcacgagac cgccgctgcc gctgcgagcg agcactga                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page