(data stored in ACNUC30630 zone)

EMBL: CP002010.PE369

CP002010.PE369       Location/Qualifiers
FT   CDS_pept        465434..466192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0386"
FT                   /product="Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99868"
FT                   /db_xref="GOA:D6ZY72"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY72"
FT                   /protein_id="ADG99868.1"
FT                   /translation="MQIVVATHNEGKLVEIRRILEEDLGADAENIELVSAGSLHLPDPV
FT                   ETGVTFQENALLKARAVAIRTGLPAVADDSGLIVDVMGNAPGILSARWAGAHGHDKANN
FT                   ALLLAQIEDIPDDKRTARFRCAAALVVPDAEASADVTGGVAADGITVYTTAADGSTAPV
FT                   HARYAIKSETVELGDMPGRIIREARGEHGFGYDPLFVPDDQPAGRVSTEPDHEGEPLTS
FT                   AEMTPAEKNAISHRGKALKALVPAIEALLH"
     atgcaaatcg tcgtcgcaac ccataacgaa ggcaagcttg tggaaatccg ccgcattctc        60
     gaagaggatc ttggcgcgga tgccgaaaac atcgaactgg tgtccgctgg cagccttcac       120
     ctgccggacc cggtggaaac cggcgtcacc ttccaggaga acgcgctgct caaggcccgc       180
     gccgtggcca tccgtaccgg tctgcccgct gtagcggatg attcaggtct catcgtcgat       240
     gtgatgggta acgctccggg cattctgtct gctcgctggg cgggtgctca cggccacgac       300
     aaggccaata atgcgctgct gctcgcccaa atcgaagata ttccggatga caagcgtacc       360
     gcgcgcttcc gctgcgccgc cgcgctggtg gtcccggacg ccgaggccag tgccgacgtg       420
     accggtggag tggctgccga cggcatcacc gtttacacca cggctgccga tgggagcact       480
     gccccggtgc atgcccggta cgccatcaag tcggagacag tggaactcgg cgacatgccg       540
     ggtcgcatca tccgcgaggc tcgtggcgaa cacggtttcg gttacgatcc gctgttcgtc       600
     ccggacgacc agcctgccgg tcgcgtcagc actgaacctg accatgaagg cgagccgctg       660
     accagcgccg aaatgactcc ggccgagaag aatgcgattt cccaccgagg caaggcgctg       720
     aaagccttgg tccccgctat cgaggcgctg ctgcactaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page