(data stored in ACNUC30630 zone)

EMBL: CP002010.PE372

CP002010.PE372       Location/Qualifiers
FT   CDS_pept        469345..470625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0390"
FT                   /product="Methicillin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99871"
FT                   /db_xref="GOA:D6ZY75"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY75"
FT                   /protein_id="ADG99871.1"
FT                   /translation="MSATANRTDTTYTFGVITPEEFDRLSEATSQGSFQQWSGQVRLAK
FT                   IRGHEAECVGVCDASGNLVAGCVILYLNGRFGADGSVYFGPIGISDDPALLRAITEAIR
FT                   ESARRHHAVSVACWPNVAYRLYSSDGQPDGEPNDALLTGFTDAGWTHGGFHTGYDVVCQ
FT                   WMYVKDLTGITNGKELLASFGKRAQWSVKRAQSMGVHVREIGPDEFDVFADIERRTGER
FT                   RGFATRGADYFRQFKQAYGADAHFMLAEIHIAEYVADMTAKREALQTKVAQLQTKYDER
FT                   PTTRIERQLGEESRNLAAADKRLAEVEGYAKKGDVLPAAASMFVSHPNEVVYQYSGSLE
FT                   EYKPFYASALIQYEAMLHLCVEQGVSRYNFYGISGVFDDPNDEGRGVLEFKQGFNGYVE
FT                   QMVGKFTLPVDKFRFGVSNLAHKLLHR"
     atgagcgcga ctgcgaatcg aacagatacg acgtatacgt ttggcgtgat tacgcccgaa        60
     gagttcgacc ggctttccga agccacaagc cagggcagct ttcagcaatg gtccgggcag       120
     gttcgtcttg ccaagattcg tgggcatgaa gccgaatgcg ttggcgtgtg cgacgcatcc       180
     ggcaatctgg tagccggctg cgtgattctg tacctcaatg gtcgtttcgg tgcagatggc       240
     tccgtatatt tcggccccat cggcattagc gatgatccgg ctctgctgcg ggccataacc       300
     gaggcgattc gtgaatcggc ccgtcgccac catgctgttt ccgtggcatg ctggcctaac       360
     gtcgcctacc gtctgtattc ctcggacggg cagcccgacg gcgagccgaa cgatgcactg       420
     ctgaccggat tcaccgatgc cggctggacg catggcggat tccataccgg ttatgacgtg       480
     gtctgccagt ggatgtacgt caaggatctc accggcatca ccaacggcaa ggaactgctg       540
     gcatcattcg gcaaacgcgc tcaatggagc gtcaagcggg cgcagtcgat gggcgtgcac       600
     gttcgcgaaa tcggccccga cgagttcgac gtgttcgccg atatcgaacg gcggaccggt       660
     gaacgccgcg ggttcgcgac gcgcggcgcg gactatttcc gccagttcaa gcaggcgtat       720
     ggcgcggatg cgcatttcat gctcgcggaa atccacatcg ccgaatatgt ggcggatatg       780
     accgccaagc gcgaggcctt gcagaccaag gtcgcacagc tgcagacgaa atacgatgaa       840
     cgtccgacca cgcgcatcga acgtcagctg ggggaggaat cgcgcaatct cgcggccgcc       900
     gacaagcgtc tggctgaggt ggagggatat gccaagaagg gcgatgtgct gccggcagcg       960
     gcttcaatgt tcgtcagtca ccccaatgag gtggtctatc agtattccgg ttcgttggag      1020
     gagtacaagc cgttctacgc ctcggcgctg attcagtacg aagcgatgct gcacctgtgt      1080
     gtggaacagg gtgtgagccg ctacaacttc tacggcattt ccggcgtgtt cgacgatccg      1140
     aacgacgagg gccgcggcgt gctggaattc aagcagggct tcaacggcta cgtcgagcag      1200
     atggtaggca aattcacgtt gccggtggac aagttccgct tcggcgtgag caatctggcg      1260
     cacaagctgc tgcaccggta g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page