(data stored in ACNUC30630 zone)

EMBL: CP002010.PE387

CP002010.PE387       Location/Qualifiers
FT   CDS_pept        490640..491860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0407"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99886"
FT                   /db_xref="GOA:D6ZY90"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY90"
FT                   /protein_id="ADG99886.1"
FT                   /translation="MSMNVWKRATLAIVRKPVRSGIIGLLMLMVFTSLVAQVGVSTALR
FT                   TMSDSIGAGMGIGFTVSAGENPISAEEASRFSRIPGVTKTAYATKTLAQVDGARPVMPR
FT                   QGPRLDSDLAMQVSVLGTTDSSLSEEFQSGLYRLEQGRHISGDGDNVLVHRDFALQNGL
FT                   SVGSTFRLQQEGRNATVRVAGIFSGNVQAQSPLPSDTSENLIYSGRRVTSALTGNDQIG
FT                   MIRCLSDNPQDLSAAVSQAKTMAGGKYDVTDDSARLSGVLQSVQTVRDLVRMVLLSVCL
FT                   ADVLVLAMALVFWIRSRIHEIGTLLALGIGKMQIVAQLAIETGLMAAVAALCSLGTGAM
FT                   LSGYVSSRLLRDSGVAPLESLHVEALPPEQTLLILLLGCAVIAVALAVSCAAVLSKSPK
FT                   SILSSMR"
     atgagcatga atgtgtggaa gcgtgccacg ttggcgattg tacgcaagcc ggtacgcagc        60
     ggcatcatcg gtctgctgat gctgatggtc ttcacgagcc tggtggcgca ggtcggagtc       120
     tcgacggccc tgcgtaccat gtccgacagc atcggcgcgg gcatgggcat agggtttacc       180
     gtcagcgccg gcgagaatcc catcagcgcc gaggaggcga gccggttctc gcgtatcccc       240
     ggtgtgacga agaccgccta tgcgacgaag accttggcgc aggtggatgg cgcgcgcccg       300
     gtcatgcccc ggcagggccc ccgattggac tccgatctgg ccatgcaggt cagcgtgctg       360
     ggcaccaccg attcctcatt gtccgaggaa ttccagagcg gcctgtaccg cctggagcag       420
     ggccgccata tctcgggcga cggcgacaat gtgctggtcc accgcgactt cgcgctgcag       480
     aacggcctat cggtcggctc gacattccgt ctccagcagg aggggcgcaa cgccacggtg       540
     cgtgtggccg ggatcttctc cggcaacgtg caggcccaaa gccccctgcc ctcggacact       600
     tccgagaacc tcatctattc gggcaggcga gtgacctccg ctctgaccgg aaacgaccag       660
     atcggcatga tccgatgcct gtcggataat ccgcaggacc tgtccgcggc ggtcagtcag       720
     gccaagacca tggccggtgg caagtacgac gtcaccgacg attcggcccg gctctccggc       780
     gtcctgcaat ccgtacagac ggtgcgtgat ctggtgcgca tggtgctgct gtccgtctgc       840
     ctcgcggacg tactggtgct ggcgatggcg ctggtcttct ggattcgctc acgcatccat       900
     gagataggca cgcttctggc cctcggcatc ggcaaaatgc agatcgtcgc acaactcgcc       960
     atcgaaaccg gactcatggc ggcggtcgcc gccctgtgtt cgctgggcac cggcgccatg      1020
     ctgtcgggat acgtgtcttc ccgactgttg cgcgattcgg gcgtcgcgcc gttggaatcg      1080
     ttgcacgtgg aggccttgcc gcctgagcag acgctgctca tcctgctgct cggatgcgcg      1140
     gtcatcgccg tggcccttgc cgtgtcatgc gccgccgtgc tgtccaaatc cccgaaatcc      1200
     attctttcct ctatgcgtta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page