(data stored in ACNUC30630 zone)

EMBL: CP002010.PE388

CP002010.PE388       Location/Qualifiers
FT   CDS_pept        491873..492508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0408"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99887"
FT                   /db_xref="GOA:D6ZY91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY91"
FT                   /protein_id="ADG99887.1"
FT                   /translation="MSNCLQLDHVDYAYGAAKILVLSDVSADFESGKMYAITGPSGAGK
FT                   STLLSLLAGLDAPSRGVVRFEGEDIAASGYAKHRREHVSLVFQDHNLIDYLTPEENLRL
FT                   VSTKADMKILEELGLSREESKRNIMHLSGGQRQRVAVGRALVAPGRAILADEPTGSLDP
FT                   EMTDEVIHLLQHAAHQLGKCVIVVTHSKRVADSADVVLRLRSKKLTRA"
     atgtctaact gtctgcaact ggaccatgtc gattacgcct acggcgcggc gaagatcctt        60
     gttctctcgg atgtcagcgc ggatttcgaa tccgggaaga tgtatgcgat caccggcccg       120
     tccggcgccg gcaagagcac gctgctgtct ctgctggccg gcctggacgc cccctcccgg       180
     ggagtggtcc gcttcgaggg ggaggacatc gccgcatcgg gctatgcgaa gcaccgtcgg       240
     gagcacgtgt ccctggtgtt ccaggaccat aacctgatcg actacctcac ccccgaagag       300
     aacctgcggc tggtcagcac caaggccgat atgaagatcc tcgaggaact gggtttgagc       360
     cgtgaggaat ccaagcgcaa catcatgcac ctgtcgggcg gccagcgtca acgggtggcg       420
     gtcggccgcg cgctggtcgc cccgggccgc gcgatcctcg cggacgagcc gacgggcagc       480
     ctcgacccgg agatgaccga cgaggtgatt catctgctgc agcatgccgc ccatcagctc       540
     ggcaaatgcg taatcgtggt gacgcattcc aagcgtgtcg ccgactccgc cgatgtcgtg       600
     ctgcgtctca ggagcaagaa actgacccgg gcgtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page