(data stored in ACNUC30630 zone)

EMBL: CP002010.PE401

CP002010.PE401       Location/Qualifiers
FT   CDS_pept        complement(515633..516436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99901"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTJ8"
FT                   /protein_id="ADG99901.1"
FT                   /translation="MPADVPGHDLLGSHIVYGSQIRLAVGDPELGDVRAQLHPRPVGRE
FT                   VAVQQVLRPRARLAPVRAVFPVRVRPAYPAFQAHAPHDLQHALVAHPHPELVHEAHAYL
FT                   PVAAPVGRAREYLGDHRLDVRPGHGGRMRQKMVIRAFRQSGRPEQVPEPMSQPRQHGDD
FT                   HRSVPVADLHASRASTFSRYATLALRYAFSSSRSCSLVGAGLGLDFAPLGLPFGFGRSA
FT                   SGPPDRYSRHQRSNGVRLAILCFSMTSAFVSPCSTWSRTAASFVS"
     atgccggctg acgtcccggg ccacgatctc cttggatccc atatcgtata cgggagccag        60
     atacgccttg ccgtcggcga ccctgaactc ggtgacgtcc gtgcccagct tcacccacgg       120
     ccggtcggcc gtgaagtcgc ggttcagcag gttctccgcc ctcgcgcccg tctcgccccg       180
     gtacgagctg tatttccggt acgggttcgg cctgcgtatc cggcattcca ggcccatgcg       240
     cctcatgacc ttcagcacgc tcttgtggct cacccgcacc ccgaactcgt gcacgaggca       300
     catgcgtatc tgccggtggc cgcacccgtt gggcgtgcgc gcgaatatct cggcgaccat       360
     cggctcgatg tccggccggg tcacggcggc cggatgcgac agaagatggt aatacgtgct       420
     tttcgccagt ccggccgccc tgagcaggtg ccggagccga tgtcccagcc ccgccagcat       480
     ggagacgatc accgttctgt cccggttgcc gatctccacg ccagcagggc gtcgactttt       540
     tccaggtacg cgaccctcgc cttgaggtac gcgttctcct cctcaaggag ctgttccctt       600
     gtgggagccg gcctcggcct ggatttcgcg cccttgggcc tgcccttcgg tttcggacgc       660
     agcgcgtccg ggccgccgga ccggtactcg cggcaccaac gctccaacgg ggtgagactc       720
     gcgatcctgt gcttctccat gacttcggcc ttcgtcagcc catgctccac atggtcgcgc       780
     accgccgcga gcttcgtctc gtag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page