(data stored in ACNUC30630 zone)

EMBL: CP002010.PE405

CP002010.PE405       Location/Qualifiers
FT   CDS_pept        518815..519870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0428"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99904"
FT                   /db_xref="GOA:D6ZTK0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTK0"
FT                   /protein_id="ADG99904.1"
FT                   /translation="MSKARKTAASSGEPDFWRVARDWLHHWLPKVRGSSPKTVEAYRIG
FT                   LESYVRWLETTEGTQRSHIGFGHFDRARLGRWVEWMRTERGYSDRTIMPRMTTMRVFLD
FT                   HAGLEHPALTALGNDAAGIRVKPPAREPVDHLGEEHTKALLTAWGTGDAKSRRNRMLPI
FT                   LMYDTAARIGELAALTIADVGMDKPARVTLTGKRGKSRVVPLGERTRTHLAAYLEEFHP
FT                   GPSTRDGDRPLFHSTRNGAIQPLSVDRIDEIPKTAAARARRGTCPSMPERVHCHLIRRT
FT                   RAMDLYQQGVPLPLIMQLLGHESMSTTSASYAFATLDMMRKAVDAANPGPDPSKETWLS
FT                   EQRLRQLHTLK"
     atgagcaagg caaggaaaac ggccgccagc tccggtgaac cggacttctg gcgagtcgcg        60
     cgcgactggc tgcaccactg gctgcccaag gtgcggggca gctcgccgaa gaccgtcgag       120
     gcgtaccgca tcggcctgga atcctacgtc cgatggctcg aaaccacgga aggcacgcag       180
     cgcagccaca tcggtttcgg gcatttcgac cgggcgcgcc tgggccggtg ggtcgaatgg       240
     atgcggaccg agcgcgggta ctcggaccgc accatcatgc cgaggatgac gacgatgcgc       300
     gtgttcctcg accacgcggg cctcgaacac ccggcattga ccgcgctggg caacgacgcg       360
     gccggcatac gtgtcaaacc acccgcgcgc gaacccgtcg accacctcgg ggaggagcac       420
     accaaagcgt tgctgaccgc atggggcacc ggcgacgcca aatcgcgcag gaaccgcatg       480
     ctcccgatcc tcatgtacga caccgccgcc aggatcggcg aactcgccgc actgaccatc       540
     gcggacgtgg gtatggataa gccggccagg gtcacgctca ccggcaaacg cggcaagagc       600
     cgggtcgtgc ccctgggaga aaggacacga acccacctgg ccgcctacct cgaggaattc       660
     catcccggac cgtccacgcg cgacggcgac aggccgttgt tccactcgac gaggaacggc       720
     gccatccagc cgctctccgt ggaccggatc gacgagatcc ccaaaaccgc ggcggccaga       780
     gcacgccgcg ggacgtgccc gtccatgccc gaacgcgtcc actgccacct gatccgccgg       840
     acccgcgcca tggacctcta ccaacagggc gtgccgctac cgctcatcat gcaactgctc       900
     ggccacgaaa gcatgagcac aaccagcgcg tcctacgcgt tcgcgaccct cgacatgatg       960
     cgcaaagccg tcgatgcggc caaccccggc cccgacccct ccaaggagac atggctcagc      1020
     gagcaacgac tccgacaact acacaccctc aaataa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page