(data stored in ACNUC30630 zone)

EMBL: CP002010.PE414

CP002010.PE414       Location/Qualifiers
FT   CDS_pept        529157..530554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99913"
FT                   /db_xref="GOA:D6ZYB7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB7"
FT                   /protein_id="ADG99913.1"
FT                   /translation="MMQRNEKSMGTDERPEANAESGSSTSPARGDIVDTFWDIPPISFD
FT                   ENDGGIAQGDNGTGTVAGGVQSVFPSFDEVLEWPTASAANTAGDASSPSDAVATAPMTF
FT                   AAPDTAESAQSPQQDNNATLPLFAPISDDKPQRDSAIDDLNIDFSAIEQNPEPVEEPEE
FT                   DRVAETPRGGKGGKKRTKGIIISVIVALVVIAAIIGGVWYWRSSEQRQESRQLHQDALT
FT                   ACAEAVDLNSTAQKALTKALADTKSAQSITADQVADGATVDALKKAVAAVKNVEAVECK
FT                   TSASTSDLKEYAKTATSQTKTAKKNATAITAAAKAVTDSKNAKDQANVQQALQGKIAEA
FT                   QTLLDNSLYAVDDNSTRVTLESDIANANTVLSQQGTDVKAMQDAVNTLTASMDAVNTSM
FT                   ANYSAAVEAQQEAARQKALNDYYARLRQQQLLQQQPDDEGTGDPAAGQETKPKDDQGTE
FT                   PEDEPKP"
     atgatgcaaa ggaatgagaa gagcatggga acagacgaac gccctgaagc gaacgcggaa        60
     tctggttcct ctacgtcgcc ggctcgcggt gacatcgtcg ataccttctg ggatataccg       120
     cccatctcgt tcgacgagaa cgacggcggt attgcgcagg gtgacaatgg tacggggact       180
     gttgcgggtg gcgttcagtc cgtcttcccc agctttgacg aagtattgga atggcctact       240
     gcgagtgcgg cgaatactgc tggcgatgcc tcttcccctt ccgatgctgt ggctactgcc       300
     ccgatgactt ttgcggcacc tgatactgcg gaaagtgctc agtcgcctca gcaggataat       360
     aatgcgacgc tgccgctttt cgcgccgatt tctgatgaca agccgcaacg tgatagtgcc       420
     atagacgatt tgaacatcga cttcagtgcc atcgaacaga atcccgagcc ggtggaggag       480
     ccggaagaag accgtgtggc agagactcct cgtggcggta agggcggcaa gaagaggacc       540
     aagggcatta tcatttcggt gattgttgcg ctggtggtga ttgcagcgat cattggtggt       600
     gtatggtact ggcgttccag cgagcagcgt caggaaagcc gtcagctgca tcaggatgcg       660
     ttgacagcat gcgctgaggc cgtggacctg aattccaccg ctcagaaggc actgaccaag       720
     gcgttggctg ataccaagag cgctcaaagc attacggctg atcaagtggc tgacggtgcg       780
     accgtggatg cgctgaagaa ggcagttgct gcggtaaaga acgtggaagc ggtggagtgc       840
     aagacttcag cttctacgtc ggacctcaag gaatatgcca agacggccac tagccagacc       900
     aagaccgcca agaagaacgc cactgcgatt actgccgcgg caaaggccgt gacggacagc       960
     aagaacgcta aggatcaggc taacgtccag caggcgttgc aaggcaagat cgccgaggca      1020
     cagactttgc tggacaacag cctgtatgct gtcgacgata attcaacgcg agtgacgctg      1080
     gaaagcgaca tcgccaacgc caataccgtg ctgtcccagc agggcactga cgtaaaggcc      1140
     atgcaggatg ccgtcaacac gctgactgcg tccatggatg cagtaaacac gtccatggcc      1200
     aactacagcg cagctgttga ggctcagcaa gaagcagcgc ggcagaaagc tctgaatgat      1260
     tattatgcac gattaaggca gcagcagttg ttgcagcagc aaccagacga tgaggggaca      1320
     ggtgacccgg cggctggtca ggagacgaaa ccgaaagatg atcaggggac ggaaccggaa      1380
     gatgagccga agccgtaa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page