(data stored in ACNUC30630 zone)

EMBL: CP002010.PE415

CP002010.PE415       Location/Qualifiers
FT   CDS_pept        complement(531037..532020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0438"
FT                   /product="G5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99914"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSQ9"
FT                   /protein_id="ADG99914.1"
FT                   /translation="MSKHAERTSIVKTLSRGQWAKIAAAVAAVGLIAAAGVISRDFYQA
FT                   STATHPITPTSFSATDGAASRSASRGALKSTTYVTVKVNGKSRVVLGEKDNMTTVKDVL
FT                   ETGDIVLDPEDSVSPSLDSKVSESTVISIDRANTTVETTDTDIAFNEVRKETSSLPNGQ
FT                   EKVETEGEKGVLETTSLVTRSGDKVVSSNVFTSWVKKAPVDKVILVGTATVSSPSAASL
FT                   GTTTPAGEIQSWAHDYLISNGYSEADFTAANFIISHESGWSPTATNPSSGAYGLPQALP
FT                   GSKMASAGADWQTNYQTQFKWFVNYCNGRYGSISGAYAYWQAHKSY"
     atgtcgaagc acgctgagcg aacctcaatc gtcaagaccc tatctcgggg tcagtgggcg        60
     aagatcgcag cggccgtagc cgcagtgggt ctcattgccg ctgcaggcgt tatatctcgc       120
     gacttctatc aggcgagcac cgctacgcat cccatcaccc caacctcatt ctccgccacc       180
     gacggcgcag cttcccgctc ggcctcccgt ggtgcgctca agagcaccac ttatgtgacc       240
     gtcaaggtca acggcaagtc ccgcgtggtt ctcggcgaaa aagacaacat gaccaccgtc       300
     aaggatgtgc tggaaaccgg cgatatcgtt ctcgatccgg aagacagcgt gagcccaagc       360
     ctggattcca aggtcagcga gtccacggtc atttccatcg accgcgccaa caccacggtg       420
     gagaccactg acaccgatat cgctttcaat gaagtacgca aggagacctc gagcctgccc       480
     aatggccagg agaaggtcga gaccgagggt gagaagggtg tgctggagac cacgtctctg       540
     gtgacccgct ccggcgataa ggtcgtctcc tccaacgtgt tcacctcatg ggtcaagaag       600
     gcaccggtcg acaaggtgat tctggtgggt accgccaccg tgtcttcgcc cagcgccgcc       660
     agcctcggta ccaccacgcc ggccggcgag attcagtcct gggcgcatga ctacctgatt       720
     tccaacggct actccgaggc cgacttcacc gccgccaact tcatcatcag ccacgaatcc       780
     ggctggagcc ccaccgccac gaacccgtct tcaggtgctt atggcctgcc gcaggcgctg       840
     ccgggcagca agatggcttc cgcaggtgca gactggcaga ccaactacca gacccagttc       900
     aagtggtttg tgaattattg caacggccgc tatggttcga tttccggcgc gtacgcgtac       960
     tggcaggcac acaagagcta ctaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page