(data stored in ACNUC30630 zone)

EMBL: CP002010.PE43

CP002010.PE43        Location/Qualifiers
FT   CDS_pept        62568..63422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0046"
FT                   /product="Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99542"
FT                   /db_xref="GOA:D6ZX96"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX96"
FT                   /protein_id="ADG99542.1"
FT                   /translation="MTFVGDSSTPACPRSAQHLRGAWNASETFDTVGCMHIPTQREIRY
FT                   QWERGGPVMTWALIVACVAVWLLEVLLGFIAPGLRAWLMYLGMAAPVRLVAEPWTLITS
FT                   MFLHAPNSLLHILFNMIALYSVGPVLERMIGHWRFLGLYVISGLGGSLGLMVWAAVAPG
FT                   GIGWQMAAYGASGALFGLFASLLVVYRRIGADIRSMLIWMAVNFALPFVVGGVAWQAHV
FT                   GGFVVGGILTWLLVGGVPAWRGKSLKWRMQVYGWAMVVLVVVLILLCNMANPYGWMSFG
FT                   SLH"
     atgacattcg tgggcgattc atccacgccc gcatgccctc ggtcggctca gcatcttcgc        60
     ggcgcgtgga acgcatccga gaccttcgat acagtgggct gcatgcatat tcctacacag       120
     cgggagattc gataccagtg ggagcgcggt ggtccggtga tgacctgggc gctgattgtt       180
     gcgtgcgtgg cagtgtggct actggaggta ttgctgggat ttattgcccc gggcctgagg       240
     gcttggttga tgtacctcgg catggcggct ccggtcagac tggtggctga gccgtggacg       300
     ctcatcactt cgatgttcct gcatgcgccg aactcgctat tgcatatcct gttcaacatg       360
     atcgccctgt attccgtggg cccagtgctg gaacgaatga tcggccactg gcggttcttg       420
     ggactgtatg tgatttccgg ccttggcggc tctctgggac ttatggtgtg ggctgcggtg       480
     gctccgggag gcatcggctg gcagatggca gcctatgggg cttctggagc cttatttggc       540
     ctgtttgcat cattgctggt ggtatatcgc cgtatcggcg ccgatatccg ctccatgttg       600
     atctggatgg cggtgaactt cgccttgccg ttcgtggtcg ggggcgtggc gtggcaggcg       660
     catgtcggcg gctttgtagt gggtggaata ctcacatggc tgctggtggg tggtgtgccg       720
     gcgtggcgag gtaaaagcct gaaatggcgt atgcaggttt acggctgggc catggtggtg       780
     ctggtcgttg tgttgattct gttgtgcaat atggccaatc cttacgggtg gatgagtttc       840
     ggctccctgc actga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page