(data stored in ACNUC30630 zone)

EMBL: CP002010.PE437

CP002010.PE437       Location/Qualifiers
FT   CDS_pept        558678..560588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0460"
FT                   /product="Glycosyl hydrolase family 32, N terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99936"
FT                   /db_xref="GOA:D6ZST1"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST1"
FT                   /protein_id="ADG99936.1"
FT                   /translation="MPDNYSVAIETGGYRLLELFAERCGDDAAVTITDGDGHQIASHAM
FT                   PVAERRHRFLIPVPTNVCLTVRARQLTVRFAYLSECENLLDEGVRFISMNPYDNEWDTQ
FT                   PTLDQIYDRFARPAAHFEPFARWMNDPNGLCRFQGRYHLFYQFNPYGFGWDNMHWGHAV
FT                   SRDLVHWTHLPIFLEPQPELHIDERIVGGAFSGSAVTVDACDNPCKGDDAAAIRLYLTR
FT                   HLETRGDESSVTEYQTTCLCEDGVHVSVESPVALRVNDGFGFDFRDPKVETGMGGEAID
FT                   PERAYMVTATNLPVAEFDTDAVSSAAPGISVQGTDGWFTCGPQGMPGTDKPNMDTVPAM
FT                   ALFSAKKPLKRNVTWQYEGPVLADFGHQLSRTYECPDLFQLDGKTVAIGALMHYRDKQG
FT                   RFQQVRWYVGDLKDTADGPRLQVGNSDWCDFGTGYYATQSFAADDGRRIVFGWYTDFPA
FT                   MRVEKPCIANGMMSLPRELHVRDGRLTSRPVKEVYEQLLGDRLEAHADENGTFFIVPNN
FT                   AYYTDMHLADDDDFTMLIATGTNSANGNSMELQLQRRDGVTRLVTKGTVVDDIDFDSGI
FT                   ADVRRVEIFFDRNVVEVFLNNGEAAGSMLFQGADGDGEFRFVADGKVDCVDVRVLDGIW
FT                   R"
     atgcctgaca actattccgt tgccatcgaa accggcggct accgcttgct ggaattgttc        60
     gccgaaagat gcggcgatga cgctgccgtc accattacag acggggacgg ccatcaaatc       120
     gccagccatg ccatgccggt ggccgagcgt cgccaccgtt tcttgattcc ggtgccgaca       180
     aacgtgtgtc tcacggtgag agcgcgccaa ctgaccgtgc ggttcgccta cttgtccgag       240
     tgcgagaatc ttcttgatga aggcgtgcgt ttcatcagca tgaatccata tgacaatgaa       300
     tgggatacgc agccgacgct ggatcagatc tatgatcgtt tcgctcgccc tgcggcgcat       360
     ttcgagccat tcgctcgctg gatgaatgat cctaacggcc tgtgtcgttt ccaaggacgc       420
     taccatctgt tctaccaatt caatccgtat ggttttggct gggacaatat gcactggggc       480
     catgcagtga gccgcgatct ggtgcattgg acgcatctgc caatcttcct cgaaccgcag       540
     ccggagctgc atatcgacga acgcatcgtt ggcggcgcgt tctccggatc cgcggtgacg       600
     gtggatgcgt gtgacaatcc ctgcaagggt gatgatgcgg ccgctattcg cctgtatcta       660
     acccggcacc tggagactcg cggagacgaa tcgtctgtta ctgaatacca gaccacctgc       720
     ttgtgtgagg atggcgtgca tgtgagtgtc gaatctccag tcgcgttgcg cgttaacgat       780
     ggttttggct tcgatttccg tgatccgaag gtggaaaccg gcatgggcgg cgaggcgatc       840
     gatccggaac gcgcttacat ggtgaccgcc acgaatctgc cggtcgccga attcgatact       900
     gatgctgtgt cctccgcggc gcctggcatc agcgtacagg gtacagacgg ctggtttacg       960
     tgcggtccgc aaggcatgcc cggcaccgac aagcccaata tggatacggt gcctgccatg      1020
     gcgctcttct ccgcgaagaa accgctcaag cgcaacgtga cgtggcagta tgaaggaccg      1080
     gtgctcgccg acttcggcca ccagctgtca cgtacctacg aatgtcctga cctgttccag      1140
     ctcgacggca agacggtcgc catcggagct ttgatgcact accgtgacaa gcaaggtcgt      1200
     tttcagcagg tgcgttggta tgttggtgat ctcaaggaca ccgccgatgg cccacgtttg      1260
     caggtaggga acagcgattg gtgcgatttc ggtaccggct actacgcgac acaaagcttt      1320
     gctgccgacg acgggcgtcg tatcgtgttc ggctggtata ccgactttcc cgcgatgcgt      1380
     gtggaaaagc cgtgcatcgc taacggcatg atgtcgctgc cacgtgaact gcacgtgcgt      1440
     gacggccgct tgaccagccg tcctgtcaag gaagtgtacg agcagctgct aggcgatcgt      1500
     ttggaagcgc atgcagacga aaacgggacc ttctttattg tgccgaacaa cgcgtattac      1560
     acggacatgc atctggctga cgatgacgat ttcacaatgc tcatcgcgac tggtaccaat      1620
     tccgccaatg gtaattcgat ggaattgcag ctgcagcgtc gcgacggcgt gacccgactg      1680
     gtcacgaagg gaacagtcgt ggacgacatc gatttcgata gcggcatcgc cgatgtgcgt      1740
     cgcgtcgaaa tcttcttcga ccgtaatgtg gtggaagtct tccttaacaa cggcgaagcg      1800
     gccggcagta tgctgttcca aggtgcggac ggcgatggcg agttccgttt tgttgctgac      1860
     ggcaaggtcg attgcgtgga tgtgcgtgtg cttgacggca tctggcggtg a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page