(data stored in ACNUC30630 zone)

EMBL: CP002010.PE44

CP002010.PE44        Location/Qualifiers
FT   CDS_pept        complement(64052..64528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0047"
FT                   /product="protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99543"
FT                   /db_xref="GOA:D6ZX97"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX97"
FT                   /protein_id="ADG99543.1"
FT                   /translation="MLMADEELHETDSNNQKDWQSETSSSTAADETANKDTEQNAENAS
FT                   AEEDAAYGVNMEQVQAVLNATADKATLTPQMQRMMNRQAENTKRVEETIKGTKSNPRWF
FT                   VPLFCAFMIIGLIWCVVYYLSPSGSWPIPNIGAWNLGIGFALIMIGFLMTMGWR"
     atgctgatgg ctgacgaaga gctgcacgaa accgactcga acaaccagaa ggactggcag        60
     agcgagacct catccagcac cgctgctgac gagaccgcca acaaagacac cgagcagaac       120
     gcagagaacg cttctgccga ggaagacgcg gcttacggcg tgaatatgga gcaggtgcag       180
     gccgtgctca acgccactgc cgataaggcc acgctgaccc cgcagatgca gcgcatgatg       240
     aaccgtcagg cggagaacac caagcgtgtt gaagaaacca ttaagggcac caagtcgaac       300
     ccgcgttggt tcgtgccgct gttctgcgcg tttatgatca tcggcctgat ttggtgtgtg       360
     gtgtactacc tctccccgtc cggctcctgg ccgattccga acatcggcgc gtggaacctg       420
     ggcatcggct tcgccctgat catgatcgga ttcctgatga cgatgggatg gcgctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page