(data stored in ACNUC30630 zone)

EMBL: CP002010.PE453

CP002010.PE453       Location/Qualifiers
FT   CDS_pept        584783..586234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99952"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU7"
FT                   /protein_id="ADG99952.1"
FT                   /translation="MLPFRFESNGAEILFYYDVTHCETMHGVLRSVVPGDQYVGILVAV
FT                   LSVMEQCEEHRVPLSYVQWDPKSVYISAQGYPLFVVVPALGLEPDRNTATTLLQTLADA
FT                   RRTRLEDAVVQGYQRALAEFLGRNSLVNADALHDFMAYLLPGTVQPRQAQSAQSTHEDN
FT                   GSETQFGATVVSDGTMVGATRFGATVLSSKPKLQTTPQQAAMPTTSAAPSTHATPAAPA
FT                   MPAAHAAPAQPTPVTSSSPVTQPTPAMPIAVNLPRKQETQPARENPVREQYIREDFARG
FT                   VASNVAAAAAAGDAATAAAVADSAATAAVAEANTDNTATAHNATNAVNNIAAARVPATN
FT                   NVVRPILPVSAVSTALRADENDSEGETMLRLYTDKSRGFTVTRLRDGKAITVHATRATI
FT                   GRSKTADIHMGGNTNVSRIHAVIDMLDDGRFCITDNHSANGTAVGGRELASGGCEYVAS
FT                   GGDFTLADDTFVISPTIEGREEPKR"
     atgctgccgt tccggtttga aagtaatggc gcggaaatcc tcttctatta cgacgtgact        60
     cattgcgaga ccatgcatgg cgtgttgagg tcggtagtgc ctggcgacca atatgtgggc       120
     atactcgtgg cggtattgtc cgttatggag caatgcgagg agcatcgcgt gccgctgtcg       180
     tacgtgcagt gggaccccaa aagcgtgtat atctccgcac aggggtatcc gctgttcgtg       240
     gtggtgccgg cgctgggact ggaacccgat cgcaacaccg ccaccacttt gctgcagaca       300
     ttggccgatg cacgccggac ccggcttgag gatgccgttg tgcaaggcta tcagcgtgcg       360
     ctcgccgagt tcctggggcg caattcactg gttaatgcag atgctctgca tgattttatg       420
     gcgtatttgc tgcccggcac tgttcagccg cgtcaagcgc agtcagcgca gtcgactcat       480
     gaagataatg gttcggagac gcaattcggc gcgaccgtag tgtctgacgg caccatggtc       540
     ggtgccacgc gatttggcgc cacagtattg agctccaagc ctaaacttca gacgacgccg       600
     caacaggccg caatgccgac gacttccgcg gcaccgtcaa cgcatgcaac gccggcggct       660
     cctgcaatgc cggcagcaca cgcggcaccg gcacagccga ctcctgtaac gtcgtcctcg       720
     cccgtgacac agccgactcc tgcaatgccg attgccgtaa atcttccccg caagcaggaa       780
     acgcagcccg ctcgtgagaa tcccgttcgc gaacaatata tccgtgaaga tttcgcccgc       840
     ggtgtggcat ccaatgtggc ggctgctgcg gccgcgggtg acgccgctac tgccgcagcg       900
     gtcgcggaca gcgcggcaac tgccgccgtg gccgaggcta acaccgataa caccgcaacc       960
     gcccataacg caaccaacgc cgtcaacaac attgccgccg ctcgcgttcc cgccactaac      1020
     aacgtcgttc gccctatcct ccctgtcagc gccgtcagca cagcactgcg tgccgacgag      1080
     aacgacagcg aaggcgagac gatgctgcgc ctctacacgg acaagtccag aggctttacc      1140
     gtcacacgat tgcgcgacgg taaagcaata acggtgcacg ccactcgagc caccatcggg      1200
     cgatcgaaaa ccgcagacat tcacatgggc ggcaatacga acgtcagtcg tatccatgcg      1260
     gtgattgaca tgctggatga tggacgtttt tgcatcaccg acaatcattc ggccaacggc      1320
     actgcggtag gtggccgcga actggcaagc ggcggttgcg aatatgtggc atctggcggc      1380
     gatttcacgc tggccgacga cacattcgtg atctctccta caatagaagg cagagaagaa      1440
     ccgaagcgat ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page