(data stored in ACNUC30630 zone)

EMBL: CP002010.PE458

CP002010.PE458       Location/Qualifiers
FT   CDS_pept        complement(590800..593313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0481"
FT                   /product="transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99957"
FT                   /db_xref="GOA:D6ZSV2"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV2"
FT                   /protein_id="ADG99957.1"
FT                   /translation="MTFDQSSITNTNTAAYAGSSGTYTGTSSGTYTGTSTTTGSWADST
FT                   HSVIWMTRGNVLRGMGLSRQPWGKRITSLVLIAAMMLLAQANLIDVYGGVATWAIAAVP
FT                   ATLLGAIIALAGMLPALRLWWQIVFLAFAQFIIGPVVTLSSTTSHYVIPTLKTLSSGWE
FT                   MTFGSFKYIISVDPPLGTQDGVLLAVWTIGLWLTFLTGVFAINANAWLSLVGVLPLAAA
FT                   VAVCALLGTDSGWQRAICGIAFALLLIIWLSWRLELLEWGRWISALIIVVLAAGLAFGG
FT                   TLLVPQDRFVLRDRYDPPLSPYDYTSPLSGMRSYIKDHKKDVLLTVHNLPAGTPVKLAV
FT                   MDRFDGTVWNLSDSSEATDSSNYHRVGTTIKADEQGESFTATFTVDQGLTDTWLPLAGA
FT                   ATGVSFANDADNGNDTFYYNTDTDSAIIPAGTRKSLTYTESGIIARKPTDKQISSAAAA
FT                   RITQPEAQDVPDSASKLATSIAGGQSSGGAAATALADTLKDSGWFSHGLEGDYPSDAGH
FT                   GNYRINKLLAGTAMVGDSEQYASAMALMARELGLPSRVVLGFLPKNEDGEITDARTEKT
FT                   SGNGTKIEFTGNDVTAWVEIKLQGLGWVAFYPTPKETKVPDENQNLTPPNPQTLVRQPP
FT                   VPLTDPLRDQTQARGQSSLAGADADDSPTNLFWVRFWRVTRKVALYGSPLWTLLIVCGL
FT                   ILMFKAMLLARARRHGSPKARVAAGWNAIRMLAEQSGITAKGTRRDQAGAIARQLGTDD
FT                   QALIQLGREADYATFSGQDIESGQATTYWTGVDQLRKAMLASLPRFRRIRTRLSLKSVA
FT                   ILSNRHAAKSHTTHVKRARKKGKTS"
     atgaccttcg accagtccag tatcaccaat accaataccg ctgcgtacgc cggatcgagc        60
     ggcacataca ccggcacttc ctccggcacg tacaccggaa cctccaccac caccggctcc       120
     tgggccgact ccacacattc ggttatctgg atgaccagag gcaatgtgct tcgcggcatg       180
     ggcctcagtc gccagccgtg gggcaaacga atcaccagcc tcgtactcat agcggcgatg       240
     atgttgctgg cgcaagccaa tctcatcgac gtgtacggcg gcgtggccac ttgggcgatc       300
     gccgccgtac cggccacctt gctgggcgcg atcatcgctc tggcgggcat gttgccggcg       360
     ttgcgactgt ggtggcaaat cgtgtttctg gcgtttgccc aattcatcat cggtccggtg       420
     gtaacgctga gttccaccac gtcccattac gtgattccca ccttgaagac cttgagttca       480
     ggttgggaaa tgacgtttgg ctcgttcaag tacattattt ccgtcgatcc gcctctgggc       540
     acgcaagacg gcgtgctgct ggcggtatgg accatcggcc tgtggcttac gttcctcacc       600
     ggcgtgtttg ccattaatgc caacgcatgg ttgtctctgg tgggagtgct gccccttgcg       660
     gcggccgtgg ccgtatgtgc tctgctgggt acggacagcg gctggcaacg tgccatctgc       720
     ggcattgcct ttgccttgct gctgattatc tggctgtctt ggcgtcttga actgctggaa       780
     tgggggcgct ggatatccgc gctgatcatc gtcgtgctcg ctgccggcct tgctttcgga       840
     ggcacgttgc tggtgccgca ggaccgtttc gtgctgcgtg accgctacga tccgccgtta       900
     agcccctacg attacaccag cccgctcagc ggcatgcgat cctatatcaa ggaccacaaa       960
     aaagacgtgt tgctgaccgt ccataatctg ccggccggaa caccagtcaa acttgcggtg      1020
     atggatcgat tcgacggcac agtatggaac ctgtccgatt cttccgaagc cacggactcc      1080
     tcgaattatc atcgcgtggg caccacgatc aaggcggatg agcagggcga atccttcact      1140
     gcgaccttca ccgtcgatca gggattgacc gacacctggc tgccgctggc gggagcagcc      1200
     actggcgtga gcttcgccaa cgatgccgac aacggcaatg acacgttcta ctacaacacg      1260
     gataccgatt ccgccattat tcccgccggc acgcgtaaaa gcctcaccta taccgaatcc      1320
     ggcattatcg cccgcaagcc caccgataag cagatcagca gtgcggccgc ggcccgcatc      1380
     acccaaccgg aagcccagga tgttcccgat tcggccagca aactggccac gtccattgcc      1440
     ggcggacagt cctcgggcgg tgccgcagcc acggcgttgg ccgacacatt gaaagactcc      1500
     ggatggttct ctcatggact cgaaggcgat tatccctccg atgccggcca tggcaactac      1560
     cgtatcaaca agctgctggc aggcacggcc atggtgggcg actccgagca atatgcctcc      1620
     gccatggcac tgatggctcg tgagctggga ctgccctccc gtgtggtcct gggcttcctg      1680
     ccgaaaaacg aggatggcga aatcaccgat gcccgcacgg agaagacctc gggcaatggc      1740
     accaaaatcg aattcaccgg caacgatgtc accgcttggg tggaaatcaa attgcagggc      1800
     ctgggatggg tggcgttcta tccgacgccc aaggagacca aggtgcctga tgaaaaccag      1860
     aacctgacgc cgccgaatcc gcagacgctg gtccggcaac caccggtgcc gttgaccgat      1920
     ccgctgcgcg atcagacgca agccaggggc caaagctcat tggccggcgc cgacgccgat      1980
     gattcgccga ccaacctgtt ctgggtgcgg ttctggcgag tgacccgcaa ggtggccctg      2040
     tacggcagcc cattgtggac cctactcatc gtctgcggtc tgattctgat gttcaaggcc      2100
     atgctgctgg cgcgagcgcg gcggcatggc agtccgaaag cccgtgtggc agcaggttgg      2160
     aatgccatac gcatgcttgc cgagcaaagc ggcatcacag ccaagggcac tcgtcgagat      2220
     caggccggtg ccatcgcccg tcaactcggc acagatgacc aggctttgat ccagcttggc      2280
     cgggaagccg actacgccac gttctcgggg caagacattg aatcgggcca agccaccaca      2340
     tattggacag gagtcgacca attgcgcaag gcaatgctcg cttctttgcc gcgtttcagg      2400
     aggatacgta cacgactttc cctgaaaagc gtggctatac tgtcaaatag acacgcagcc      2460
     aagtcgcaca cgacgcatgt caagcgcgcg cgtaagaagg ggaagacgtc atga            2514
//

If you have problems or comments...

PBIL Back to PBIL home page