(data stored in ACNUC30630 zone)

EMBL: CP002010.PE507

CP002010.PE507       Location/Qualifiers
FT   CDS_pept        664348..665274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0530"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00007"
FT                   /db_xref="GOA:D6ZT01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT01"
FT                   /protein_id="ADH00007.1"
FT                   /translation="MMSVEIHGLNIAIGGKPIVTDVDLSIADGERVGLIGSSGSGKSMI
FT                   AKSLLGLLPREAVLSGTITMGETAILSGETAESRHGQEDDSGSDEERGAADRHHVAGER
FT                   RVATSGHDSAAYADEHTLADLRGRYVGTVFQNPAHALNPVMTVAQQIALPLRLHYDLTK
FT                   AERAERVNTMLDKVGLDRDVAGTYPHELSGGQQQRVGIATALITSPRFIIADEPTTALD
FT                   SITQRQIVDLLTSLVDDAGASMLFITHDFSVLARATTRCYVLDAGRVVESGPTADLLAA
FT                   PTTPQAQRLVAAAQTLTLHTPKEDSHE"
     atgatgagcg ttgaaattca cgggctgaat attgctatcg gcggcaaacc gattgtcacg        60
     gatgtcgatc tgtccatcgc ggacggcgaa cgggtcggcc tgatcggttc ctccggctcc       120
     ggcaaatcga tgatcgccaa gtcattgctc ggcctgttgc cgcgcgaggc cgtgctgtcc       180
     ggcaccatca cgatgggaga aaccgccatc ctgtccggag aaaccgccga gtcgcggcat       240
     gggcaggaag atgactcagg atctgacgaa gaacgcggcg cggcagatag gcaccatgtt       300
     gccggtgaac gcagggttgc cacctcgggc cacgattccg ctgcgtacgc cgacgagcat       360
     acgcttgccg atctgcgcgg tcggtatgtg ggtacggtat tccagaatcc ggcccatgcg       420
     ctgaacccgg tgatgaccgt ggcgcagcag attgcgttgc cgttgagact gcactacgat       480
     ctgaccaagg ccgaacgtgc tgagcgagtg aataccatgc tggacaaggt cggactggac       540
     cgtgacgtgg ccggcacata cccgcacgaa ctgtccggcg gccaacagca gcgcgtgggc       600
     atcgccacgg cgctgatcac ctcaccgcga ttcatcatcg cggacgaacc caccaccgcg       660
     ctcgactcca tcacgcaacg tcagatcgtg gacctgctga cctcgttggt ggacgacgcc       720
     ggcgcatcca tgctgttcat cacccatgat ttctccgtac tcgcgcgtgc caccacccgc       780
     tgctacgtgc tggacgccgg ccgcgtcgtc gaatccggac ccaccgccga cctgcttgct       840
     gcaccgacca cgccgcaagc ccaacgcttg gtcgccgccg cccaaaccct caccctccac       900
     acccccaagg aggattcgca tgagtaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page