(data stored in ACNUC30630 zone)

EMBL: CP002010.PE508

CP002010.PE508       Location/Qualifiers
FT   CDS_pept        665267..666052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0531"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00008"
FT                   /db_xref="GOA:D6ZT02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT02"
FT                   /protein_id="ADH00008.1"
FT                   /translation="MSNSSVPLLSAHSISKSFGPRTARHQVLFDVSADVHAGECLAVIG
FT                   GSGSGKSTLTRIMLGLESADSGSVEYESQSIVGGRKSPGFATLRRESGLVFQDPFSSLD
FT                   PRWQVAKSVAEPLSLQRRDLNNTDIDERVVAALTMAGLEPADFLNRYPIDLSGGQAQRV
FT                   VIARAIINEPKVILADEPMSAIDVAARIQILDAFAAIREARPSTAIIMVSHDLGVVQHI
FT                   ANRVLVLHDGRVEETGPTAEVLGNPQSDYTRQLIEAASL"
     atgagtaaca gcagtgtgcc actcctctcc gcccactcca tcagcaaatc cttcggaccg        60
     cgcaccgcac gccaccaagt cctcttcgac gtctccgccg acgtccacgc cggcgaatgt       120
     ctggccgtga tcggcggctc cggatccggc aaatccacgc tgacccgcat tatgctgggc       180
     ttggaatccg cggactccgg cagcgtggaa tacgagagcc aatccattgt cggcggccga       240
     aaatcgccgg gattcgcgac cctgcgccgc gaatcgggac tggtgttcca ggacccgttc       300
     tcatcactcg acccgcgttg gcaagtcgcc aaatcggtgg ctgaaccgct gagtctgcag       360
     cgacgtgatc tgaacaacac cgatatcgac gagcgggtgg tcgcggctct gaccatggcg       420
     ggtcttgaac cggcggactt cctgaaccgg tacccaatcg acctgtctgg tggccaggcg       480
     cagcgcgtgg tcatcgcccg cgccatcatc aacgagccca aggtaatcct cgccgacgaa       540
     ccaatgagcg ccatcgacgt ggccgcgcgc atccagatcc tcgacgcctt cgccgctatc       600
     cgtgaggccc ggccgagcac cgccatcatc atggtctccc acgatctcgg cgtggtgcag       660
     cacatcgcca accgcgtcct cgtgcttcac gacgggcgcg tcgaagagac gggtcccacc       720
     gccgaagtgc tcggcaaccc ccaatccgat tacacccgtc agctcatcga ggcagcctcg       780
     ttatag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page