(data stored in ACNUC30630 zone)

EMBL: CP002010.PE519

CP002010.PE519       Location/Qualifiers
FT   CDS_pept        681363..682238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0542"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00019"
FT                   /db_xref="GOA:D6ZT13"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT13"
FT                   /protein_id="ADH00019.1"
FT                   /translation="MTQNRAELNRNLAQMLKAGVIMDVTTPEQAKIAQDAGACAVMALE
FT                   RIPADIRAAGGVSRMSDPAMIKGIQEAVSIPVMAKVRIGHIAEARILQAIDIDYIDESE
FT                   VLSPADDVYHIDKNQFDVPFVCGAKNLGEALRRIAEGAAMIRTKGEPGTGDVIQAVRHM
FT                   RTMNKQIRELVALRDDEVYEAAKQLAVPYDLAKYVHDNGRLPVVNFAAGGVATPADAAL
FT                   MMELGAEGVFVGSGIFKSGDPAKRAAAIVKATANWQDADLLAKLSENLGEAMVGINEDE
FT                   IQTIMAARGE"
     atgacgcaga atcgtgcgga actcaaccgt aatctggccc agatgctcaa ggctggcgtg        60
     atcatggacg tcaccacgcc cgaacaggcg aaaatcgcgc aggatgccgg cgcgtgcgcg       120
     gtgatggcgc tggagcgcat ccccgctgac attcgtgccg ccggcggcgt ctcccgtatg       180
     agcgacccgg ccatgatcaa gggcattcag gaagctgtct cgattccggt catggccaag       240
     gtgcgcatcg gccacatcgc cgaagcccgc attctgcagg ccatcgacat cgactacatc       300
     gacgaatccg aagtgctttc cccggccgac gacgtgtacc acatcgacaa gaaccagttc       360
     gacgtgccgt tcgtgtgcgg cgcgaagaac ctgggcgagg cgctgcgccg catcgccgag       420
     ggtgctgcca tgattcgtac caagggcgag cccggcaccg gcgacgtgat tcaggccgtg       480
     cgtcatatgc gcaccatgaa caagcagatc cgcgagctcg tggccttgcg cgacgacgag       540
     gtctacgagg ccgccaagca gctggccgtg ccctacgacc tggccaagta cgtgcacgac       600
     aacggccgtc tgcccgtcgt gaacttcgcc gccggtggcg tggccacccc ggccgacgcc       660
     gccctgatga tggagctcgg tgccgaaggc gtgttcgtgg gctccggcat cttcaagtcc       720
     ggcgacccgg ccaagcgcgc cgctgccatc gtcaaggcca ccgccaactg gcaggacgcc       780
     gatctgctcg ccaagctgtc cgaaaacctc ggcgaagcca tggtcggcat caacgaggac       840
     gagattcaga ccatcatggc cgctcgcggc gagtga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page