(data stored in ACNUC30630 zone)

EMBL: CP002010.PE534

CP002010.PE534       Location/Qualifiers
FT   CDS_pept        699000..699992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0558"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00034"
FT                   /db_xref="GOA:D6ZT28"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT28"
FT                   /protein_id="ADH00034.1"
FT                   /translation="MKAVYASTVNHADPLAALAVGEQPEPQARPFWSTVSVRAVTVNHH
FT                   DVWSLQGVGLAAEQTPMILGTDAVGILDEDIPGKHGLKAGSEVVLYTFVGTDGAGVAPG
FT                   ERRTILSEKYPGTMAEKTSVPSANVFAKPASLTTAEAAALGTSWLTAYSLLFDAAGIKP
FT                   GDSVLIQGAGGGVSTAAIQLAHAAGLEVFVTSRDADKRSKALKLGANAALEIGARLPRK
FT                   VDAVIESVGAATWGHSVRSVRPGGTIAICGATTGDQPGAELTRLFFQDIRVQGCTMGSR
FT                   EDFARLLRFVEHADLHPVIDSVVSGLDAAPEAFARMIAGDMFGKIVIEL"
     atgaaggccg tatacgcatc caccgtcaac catgccgatc cgcttgccgc gttggcagtg        60
     ggcgagcagc ccgaacccca ggcccgcccg ttctggtcga ccgtttcggt gcgcgcggtg       120
     accgtaaacc atcacgacgt ctggtcgcta cagggtgtgg gtctcgccgc cgaacagacg       180
     ccgatgatcc tgggcaccga tgccgtgggc attctggacg aggacatccc cggcaagcat       240
     gggctcaagg ccggcagcga agtggtgctg tacacgttcg tcggcaccga tggcgcgggc       300
     gtggccccgg gcgagcgccg cacaatcctc tccgagaaat accccggcac gatggccgag       360
     aagacttccg tgccgtccgc caacgtgttc gccaagcccg caagcctcac cacggctgag       420
     gcggccgcac tcggcaccag ctggctgacc gcctactcgc tgttgttcga tgccgccggc       480
     atcaagccgg gcgactccgt gctcattcag ggcgcgggcg gcggcgtgtc cactgcggcc       540
     atccagctcg cccatgccgc cggtctggag gtgttcgtca cctcgcgcga cgcggacaag       600
     cgctccaagg cgctgaaact tggcgcgaac gccgcgctgg agatcggtgc ccgcctgccg       660
     cgcaaggtcg atgcggtgat cgaatccgtg ggggcggcca catggggcca ttcggtgcgg       720
     tcggtgcgtc ccggcggcac catcgccatc tgcggcgcca ccaccggcga ccagcccggt       780
     gcggagctca cgcgactgtt cttccaggac attcgcgtgc agggctgcac catgggttcg       840
     cgcgaggatt tcgcccggct gctgcgcttc gtggagcacg ccgacctgca tccggtgatc       900
     gattccgtgg tcagcgggtt ggacgccgcc cccgaggcgt tcgccagaat gatcgccggc       960
     gacatgttcg gcaagatcgt tattgagctg taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page