(data stored in ACNUC30630 zone)

EMBL: CP002010.PE539

CP002010.PE539       Location/Qualifiers
FT   CDS_pept        702705..703628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0563"
FT                   /product="periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00039"
FT                   /db_xref="GOA:D6ZT33"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT33"
FT                   /protein_id="ADH00039.1"
FT                   /translation="MSIMSNAKRALAIAAAAATLLSMAACGSSNAASGKSDSSGAASSG
FT                   KIEVVASINQWGSVAEDLGGSNVEVTNIMTKTNVEAHDYEPTSQDVAKFGTAKVAVVNG
FT                   ADYDPWATKAAQPTKATLVTAAETAGIKEGDNPHVWFSAKVRSNTADAITAAYQKADPS
FT                   HKDDYAKLNKEWHAKEDQLESKIKETSAKTEGLPYAATESVAWYLADDLKMTDATPKGY
FT                   AQASANESEPTPADIKDFQDTLKAGFIKMFVFNSQEANSTTDQITGAAKDANVPIVELA
FT                   EQMPKQYTNLLDWMSALVDQFAAAVK"
     atgtccatca tgtccaacgc caagcgcgcg ctcgccatcg cggccgccgc ggcgaccctg        60
     ctctcgatgg ccgcctgcgg ttccagcaac gccgccagcg gcaagtccga ttccagcggc       120
     gccgcgtctt ccggcaagat cgaggtcgtc gcctccatca accagtgggg ttccgtggcc       180
     gaagacctcg gcggcagcaa cgtcgaagtc accaacatca tgaccaagac caacgtcgag       240
     gcgcacgatt acgagcccac cagccaggat gtcgccaagt tcggcaccgc caaggtagcc       300
     gtagtcaacg gcgccgatta cgacccgtgg gccaccaagg ccgcccagcc gaccaaggcc       360
     acgctggtca ccgccgccga aaccgccggc atcaaggaag gcgacaaccc gcacgtctgg       420
     ttctccgcca aggtgcgttc caacaccgcc gacgccatca ccgccgccta ccagaaggcc       480
     gacccgagcc acaaggacga ctacgccaag ctcaacaaag aatggcacgc caaggaagac       540
     cagcttgagt ccaagatcaa ggagacttcc gccaagaccg agggcctgcc gtacgccgcc       600
     accgaatccg tggcctggta cctggccgac gacctcaaga tgaccgacgc cactccgaag       660
     ggctacgccc aggcctccgc caacgagagc gagccgaccc cggccgacat caaggacttc       720
     caggacaccc tgaaggccgg cttcatcaag atgttcgtct tcaacagcca ggaagcaaac       780
     tccactactg accagatcac cggtgccgcc aaggacgcca acgtgccgat cgtggagctc       840
     gccgagcaga tgccgaagca gtacaccaac ctgctcgact ggatgagcgc actggtcgac       900
     cagttcgccg ccgccgtgaa gtaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page