(data stored in ACNUC30630 zone)

EMBL: CP002010.PE551

CP002010.PE551       Location/Qualifiers
FT   CDS_pept        complement(721233..721796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00051"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT45"
FT                   /protein_id="ADH00051.1"
FT                   /translation="MGLMSEHVEHGFGPVWDGESRALILGSMPSPKSRAAAFYYMHPQN
FT                   RFWPVMQALFANSADPTDAVGDLPESRRAFALRHHIALWDVIASCDITGASDASIRNAV
FT                   PNDLTPILRGAPIAHIFATGAKSAQLYRKLIEPRLTEAGIAIGMTQLPSTSPANASMRL
FT                   PDLITAYREAFREYNIVVRQTTNI"
     atggggctta tgagcgaaca tgtggagcat gggtttgggc cggtgtggga tggtgagtcc        60
     cgggctttga ttttgggatc gatgccgagt ccgaaatccc gagcggcggc gttttactat       120
     atgcatccac agaaccggtt ttggccggtg atgcaggcgc tgtttgccaa ctccgctgat       180
     cctactgacg ctgtcggcga tttacctgag tcccgtcgtg cgtttgctct gcgccaccac       240
     attgcgttat gggatgtcat tgcttcttgc gatatcaccg gagccagcga tgccagcatc       300
     cgcaatgccg tgcccaacga cttgacacca atcttgcgcg gcgctccaat cgcccacatc       360
     ttcgcaaccg gcgcgaaatc agcgcaactt taccgcaaac ttatcgagcc gcgcctgacc       420
     gaagccggca tcgccatcgg tatgacccaa ctgccctcca ccagcccggc caacgcctca       480
     atgcgtttgc cggaccttat caccgcctat cgcgaagctt ttcgagaata caatatagtt       540
     gttcgccaaa ctactaatat atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page