(data stored in ACNUC30630 zone)

EMBL: CP002010.PE556

CP002010.PE556       Location/Qualifiers
FT   CDS_pept        complement(725614..726273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00056"
FT                   /db_xref="GOA:D6ZT50"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT50"
FT                   /protein_id="ADH00056.1"
FT                   /translation="MKHCDACNVDFTGDMARCPLCQNELHGEASPAAFPAQQIYLRPRR
FT                   LAVEIITFVTGAILLLHGFFSYLFSWPIPIASASAAALIISVLFINSAILHAPRPLRLM
FT                   FRYFYIMLAIALVWFVATMNHVVTMFVIPITCLVSLVFDVVLLIVLRAKAIDQYAKYLA
FT                   FDIVAGLLPLTFIPLGWAPWDVLVMVSGLVSLLVLLGLLVFARRQLFSEFGKQFSA"
     atgaagcatt gcgatgcctg caacgtcgat ttcaccggcg atatggcccg ttgcccactc        60
     tgtcagaacg aattgcacgg cgaggcctct cccgccgcat tccccgcgca gcagatctat       120
     ctgcgtccga ggcgtttggc ggtggagatc atcacgtttg taaccggcgc gattctgctg       180
     ctgcatggct tcttcagcta tctgttttcg tggccgatac cgattgccag tgcatcggca       240
     gccgcgctga tcatcagcgt gctgttcatc aacagtgcga ttctgcacgc gccgcggccg       300
     cttcgcctca tgtttcgata tttctatatc atgctggcga ttgcgctggt ctggtttgtg       360
     gcgacgatga atcatgtcgt caccatgttc gtcataccga tcacgtgtct ggtttcgctg       420
     gtctttgacg tggtgctgct tatcgtgctg cgggccaagg ccattgacca gtacgccaag       480
     tatctggcgt tcgacatcgt cgccggtctg ctgcctctga cgttcattcc gctcggctgg       540
     gctccgtggg atgtgctggt gatggtcagc gggctggtct ccctgctggt gctgctcggc       600
     ctgctcgtct tcgcccgccg tcagctcttc tcggaattcg gcaaacagtt ctcggcgtaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page