(data stored in ACNUC30630 zone)

EMBL: CP002010.PE561

CP002010.PE561       Location/Qualifiers
FT   CDS_pept        complement(733682..733804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT55"
FT                   /protein_id="ADH00061.1"
FT                   /translation="MPEGYTTGDELIVLANDGRLRHPNSVWPFDAATYDAPAAS"
     atgccggaag gctacacgac cggagacgag ctgatcgtac tggccaatga cggccgcctc        60
     cgccatccca acagcgtatg gccgttcgat gcagcgacgt atgatgcgcc ggccgcatcg       120
     tag                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page