(data stored in ACNUC30630 zone)

EMBL: CP002010.PE572

CP002010.PE572       Location/Qualifiers
FT   CDS_pept        744764..745495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00072"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT66"
FT                   /protein_id="ADH00072.1"
FT                   /translation="MMTGSQAAHCGSVSALSLGLPVSTAIPEAKGTLPKALFVGKAPIS
FT                   GKLKQRLVNEIESITMLALVRSINTGLADGKLVPEVLVIGLKLTAKATGIPNEVIDLIA
FT                   GQRKSGIVFVCVRDVPFEGSTREECAFAVRRAIPGRAGHTPIYRVYAGDWQPAGEAQLE
FT                   LAGSTIDELWASLCSQTILGTPEIENLDARIIRHTEIARLESEVDKLTRDHQRVKNPVQ
FT                   RNEIYAKLHKAKTQLAKLREA"
     atgatgactg gttcgcaagc cgcacactgt ggttccgtat ccgcgctttc actgggactg        60
     cccgtctcca cggcgattcc cgaagccaaa ggcacactgc cgaaagcctt gttcgtgggc       120
     aaggcaccga tttcaggcaa actcaagcag cgattggtga acgaaatcga atccattacc       180
     atgctggcgt tggtccggtc gattaacact gggcttgcgg acggcaaact ggttccggaa       240
     gtgctggtca tcggactgaa gcttacggcc aaagccactg gcataccgaa cgaggtcatc       300
     gatttgattg ccgggcagcg taaatcgggc atcgtgttcg tgtgcgtacg cgacgtgccg       360
     ttcgagggca gcacacgtga ggaatgtgcg ttcgccgtgc gtcgggcgat accggggcgt       420
     gccggccaca cgccgatcta tcgggtatat gccggcgatt ggcagccggc gggggaggcc       480
     cagctggagc tggccggctc tactattgat gagctgtggg cctcgctgtg ctcacagacc       540
     attctgggca cgccggagat cgaaaatctg gatgcgcgca tcattcgcca tactgaaatt       600
     gctcggcttg aatccgaagt ggacaagctc acccgcgacc atcagcgcgt caagaatcct       660
     gttcagcgca atgaaatcta tgccaagctc cacaaggcca aaacacagct cgcaaaactg       720
     cgcgaagcat ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page